KEGG   Salmo salar (Atlantic salmon): 106579902
Entry
106579902         CDS       T04363                                 

Gene name
adamts13
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sasa01002]
    106579902 (adamts13)
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     106579902 (adamts13)
Peptidases and inhibitors [BR:sasa01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   106579902 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_4 Reprolysin_3 Reprolysin_5 TSP1_CCN Reprolysin_2 TSP1_spondin Peptidase_M10 Peptidase_M66
Other DBs
NCBI-GeneID: 106579902
NCBI-ProteinID: XP_014015732
UniProt: A0A1S3NJZ7
Position
ssa20
AA seq 1555 aa
MAALALLCLLSVLPGSTAILMRSPLEELFLHSLDQKDMVFYFGTDSATSVPEFQLIWTDC
ASTELHTGPWRCSFETEGKRFVLGLGERKQSFSCQSTLETARNTTLNIIRKRHAMCCQQA
KVLHPPSTKGFLTICARKMQGLVVAGKEKERLYIQPVLQKHIHLTEARNCSSPGTPHLVF
HQPFTARGPPRHSHMKRLRSRRSAIMPEVTHLELLVVVAPDVQLVHRQDTERYILTNLNI
ASELLRDMTLGANMRVHLVRMIILSEPEPEINISTNISSSLRSVCEWARRVIPSNDTDPL
HADLVLYITRFDLELPNGNKQVRGVAQLGGACSSQWSCVITEDTGFDLGITIAHEIGHSF
GINHDGTGNTCSSSGYMMASDGGYNSVDLTWSQCSRQQLYTFFSEGKAECVKDLPVLVGS
LQDWKPGLYYGVDDQCRIAFGSTARACSFTNTDLPVCRVLSCHIKPDDNSSCKRLLVPLL
DGTECAPNQWCLKGRCVSPDQLSPSSSVVVHGSWSSWSQFSPCSRICGGGVTSRTRQCNN
PRPAFGGNDCKGRDTEAELCHQQQCERTQLAFMAEQCSQTDLQPLYLSPNTASLYTWIPA
VGFVTGDEQCRYMCQCKGENFIVSRGSQFVDGTRCEPDSPAPLGATTACLGGTCQLFGCD
GVLKSGKVEDVCGVCGGDGSSCSLTSQSYSGGQAREYVTFLTLPVNATQVHIVNRAPVFT
HLAVLIGNQYVVSGSGSIALNITHPSPLEDGRLVYRLYLTPDLLPLMEELLLPGTVTEET
HIQVYRKYGKEYGEQTNPNITYHFYTPISNNAFIKEIPRGKWTVVTTSCSVTCGSGIQKS
MYVCMDEDTKEHLEEVYCDSAPLLLLQQTTCHLPACPPSWEMGEFGPCSALCGGGEKVRP
VRCVQKQGADVLQVAVSECPQPSATQSVDTCNFQPCPARWNASEAGECSAVCGPGAAKRI
VTCVRYEGGHDVEVDHSLCSGLFKPPVLVSCVIDVCPIGWESKGQDQPTLNKSPGLRYRS
RYLTVYVWSPVIGQCSKTCGNGTLQVWFSCLDHQTRLAVPEVYCDASSKPEPHTESCNPS
PCPPMWRYKQGVCSVSCGGGVAHRVLYCSQETEGDEEVVVNNTECSNMTKPIAVVTCNSN
SCPARWRVLRTGACSTSCDLGVARRHVSCVEYIHGEDREVSEERCHAAVKPATTVPCLVQ
VCTFRWDVKDWNQCSVPCGYGIQSRAVSCMGPTKPEPLSPLLCMHMPKPITIRGCQMDDC
RVLQKTSPLTHTHTTNAPSLETRDQLPSPQGMEVTPTDEEPLLSPTLSLTQTTLTATELT
TPQTTTAMPTVTPKTGLCGQLLLEESGTVDLRHETGRCILSIGRPLDEVIHLKVESSSLS
CKKREYVAFYDRLVLVRKCDQLEDTELTSRTNVLLVRQHLLSPGNGVLLTYSSQKNNKKS
HHQDCDVQLFAPSGVIENPTMTSALGSHTCRVLINAPPSVKIRIRALSMGPVVNSTAAQS
TFIMIRDVDVLKTNVFKGQQLFDWRSAGNMAEIEFHGEYLHSNGSFRAEYSFVEP
NT seq 4668 nt   +upstreamnt  +downstreamnt
atggcagccttggcgctgctctgtctgctgtcagtgctgccaggctccacagcaatacta
atgagatctccattggaggagctatttctgcactccttggatcaaaaggacatggtgttt
tattttggtactgactctgctacctcagtgcctgagtttcagctcatctggacagactgt
gcctctacggagctccacactggcccctggcgatgctccttcgagaccgaagggaagcgc
tttgtgctggggctcggggagaggaagcagtccttctcctgtcagtccacattagagaca
gctcggaacaccactctcaacatcataaggaaaaggcatgccatgtgttgtcagcaggcc
aaagttctacatcctccttcaactaaaggatttctcaccatctgtgccaggaaaatgcaa
ggcctggttgttgcaggtaaagagaaggagagactatacattcagccagtgcttcaaaaa
cacattcatctgactgaagccagaaactgttccagtccaggaacacctcatctggtgttc
caccagccatttactgccagaggccctcccagacactctcacatgaagaggttgcgtagc
cgaaggtcagctataatgcctgaggtgacccacctggagctgctagtggtggtggcgcct
gacgtgcagctggttcacaggcaggacacagagagatacatacttaccaacctcaacatt
gcctcagagctgctgagggacatgacactgggagccaacatgagagtgcatctggtccgc
atgatcatcctctcagaaccagagccagagattaacatctccaccaacatctcctcgtct
ctgaggagtgtgtgtgagtgggccagaagggtcatcccctctaatgacacagaccccctg
catgctgaccttgtgttatacatcacaagatttgatctggagctgcccaatgggaacaag
caggtgaggggcgtggcccagctaggcggggcatgttctagccaatggagttgtgtaatc
acagaggacacaggctttgatctgggcatcaccatcgctcatgagataggccacagcttt
ggtataaaccatgatgggaccggtaacacatgcagcagcagtggctatatgatggcctct
gatggaggctacaacagtgtggatctcacctggtcccagtgcagcagacagcagctgtac
acattcttcagtgaaggcaaggctgagtgtgtgaaagacttgcctgtcctggttggctct
ctgcaagactggaagccaggcctttactatggcgtggacgaccagtgccggatagcgttt
ggtagcaccgccagggcgtgctccttcaccaacactgacctgcctgtgtgccgtgttctc
tcctgccacatcaaacctgatgacaacagctcatgtaaacgcctgctggtgcctctgttg
gatgggacagagtgtgcacccaaccagtggtgcctgaagggccgctgtgtgtccccagac
cagctcagcccctcttcctctgtggtggtgcacgggtcctggtccagctggtcccagttc
tccccatgctcacggatatgtggtgggggcgttacttcccggaccaggcaatgcaacaac
ccacgacctgcatttggtgggaatgattgcaagggcagggatacagaggctgaactttgt
caccagcagcagtgtgaaaggacccagctggccttcatggcagagcagtgctcccagaca
gatctacagcccctgtacctgtcccccaacacggcctccctctacacctggatccccgct
gtaggctttgtcacaggggatgaacagtgcaggtacatgtgccagtgtaagggagagaac
ttcattgtgagccgcgggtctcagtttgtggatgggactcgttgtgaaccagacagtcca
gctccccttggtgccacgacagcttgtctaggagggacgtgccagctgtttggctgtgat
ggagtgttgaagtctgggaaggtggaggatgtgtgtggggtgtgtggaggggatggctcc
tcttgcagtctcacctctcagtcttacagtggtggtcaggccagagagtacgtcacattc
ctgaccctgccagtaaacgccactcaggttcacattgtcaacagggcacctgtcttcact
cacctggcggtgttgattgggaatcagtatgttgtgtctgggagtggcagcattgcgtta
aacatcactcacccctctcctctggaggacggtcgtctggtttatcgtctgtacctgacc
cctgacctcctgcctctcatggaggagctgctgctgcctggaactgttacagaggagaca
cacatacaggtctatcggaaatatggaaaagaatatggagaacaaaccaatccaaacatc
acctaccacttttatactcccattagtaataatgcttttataaaagagatacccaggggc
aagtggactgttgttacaacatcctgctctgtcacctgtggctctggcatacagaaatct
atgtatgtctgtatggatgaagacaccaaggagcatctggaggaggtctactgtgattca
gctccccttctcctgcttcagcagacaacctgtcacctcccagcctgtccccccagctgg
gagatgggagagtttgggccctgcagtgccttgtgtggtggtggagagaaagtacgccct
gtgagatgtgttcaaaagcaaggagcagatgtcctacaggtggcagtttctgaatgtcca
caaccctctgccacacaatcagtggatacatgcaactttcaaccctgccctgcaaggtgg
aatgcgtcagaagccggggagtgttcagcggtgtgtgggcccggcgcggctaaacgcatt
gtgacatgtgtgcggtacgaaggtggtcatgatgttgaggtggaccatagcttgtgttca
gggctcttcaaaccacctgtcttagtgtcttgtgtgatcgatgtctgcccaattggctgg
gagtctaagggacaggatcaaccaacacttaacaaatcccctggtttaaggtaccgctcc
aggtacctaacagtgtatgtttggagccctgtgataggccaatgctcaaagacctgcgga
aatggtaccctgcaggtgtggttttcatgtctggaccaccagaccaggctagcagtgcct
gaggtctactgtgatgcctccagcaaaccagagcctcacacagagtcctgcaacccttct
ccttgccctcccatgtggcgctacaagcagggagtgtgcagtgtgtcgtgtggaggaggc
gttgcccatagggtgctatactgctcccaggagaccgagggagatgaggaggtggttgtg
aacaatacagagtgcagtaacatgaccaaacccatagcagtggtcacatgcaactccaac
agctgtccagccaggtggagagtgctgaggacgggggcctgttctacgtcttgtgatctg
ggggtagccaggaggcatgtctcctgtgttgagtatatccatggggaggacagggaggtg
tctgaggagaggtgccatgcagccgttaaacctgctaccacagtaccctgtctggtgcag
gtgtgcaccttcagatgggacgtgaaagactggaatcagtgttcagtgccgtgtgggtat
gggatccagtctagagcagtgtcctgcatgggacccactaagcctgagcccctcagccca
ctgctctgcatgcacatgcccaagcccatcaccatccggggctgccagatggacgactgc
agggtcttacagaagactagtcccctcacccacacacacaccaccaacgccccctcacta
gagaccagggaccagttacccagtccccagggcatggaagtcactcccacggatgaggag
ccactcctgtctcctactctcagcctgacccagacaaccctgactgcaacagaactgacc
acaccacagaccaccaccgccatgcccactgtgacacctaaaaccggtctgtgtgggcag
cttctgctggaggagtcaggcacagtggacttgagacatgagacaggtcgctgcatcctg
tcaataggtcggcccctggatgaggtcatccacttgaaagtagagtccagctccctaagc
tgcaagaaaagggagtatgtggcgttctatgacaggctggtactggtcaggaagtgtgac
cagcttgaggacactgaactgacctccaggaccaacgtcctgctggtacgccagcatctc
ttgtcccccggaaacggagtgctgctcacttacagcagtcagaagaacaacaagaagagt
caccaccaggactgtgatgtccagctgtttgctcccagcggggtcattgagaatccaacg
atgacctcagcgttgggcagtcacacctgtcgagtcctcatcaacgccccaccctcagtg
aagattaggatccgggctctgagcatgggccctgtggtcaacagcacagcagcccagtcc
accttcattatgatacgagatgtagacgtcttgaagaccaacgtgttcaagggccaacag
ctttttgactggcgatcagctggaaacatggcagagatagaatttcatggcgagtacctg
catagcaacggaagcttccgagctgaatactcattcgtggagccttga

DBGET integrated database retrieval system