KEGG   Salmo salar (Atlantic salmon): 106580092Help
Entry
106580092         CDS       T04363                                 

Definition
(RefSeq) BDNF/NT-3 growth factors receptor-like
  KO
K04360  neurotrophic tyrosine kinase receptor type 2 [EC:2.7.10.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106580092
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106580092
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     106580092
Protein kinases [BR:sasa01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   106580092
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 LRR_8 Ig_2 C2-set_2 TPKR_C2 LRR_5 LRRNT Ig_5 BiPBP_C Haspin_kinase ig ICAM_N Kinase-like
Motif
Other DBs
NCBI-GeneID: 106580092
NCBI-ProteinID: XP_014016206
UniProt: A0A1S3NLX7
Position
ssa20
AA seq 803 aa AA seqDB search
MEGAEMSAFRRGSGVILFGLCCVLMGLWRLGAACPASCSCSGTRITCVDQERGIMAFPVL
QSELEMDNITDIYIANQSSFSSINDKDLHYYRNLTNLTVINSRLTYVSRLAFQNNLKLQY
LNLKDNNLSSLSWRIFRRLNISNLILSGNPLHCSCENIWMKLWLGEEADAQDLQCTAEGG
GRKPLIRLKLPHCMVPMATLSPSKVMVQEGADVVLTCNTSGEPSPELIWKMTPLISYYEI
ETSGQVSELHLYNLSSLDNNCKITCSAGNIVGENESTVLLNILFPPNISKLSDAYQDHHW
CIPFSMSGNPKPELRWLLNGEPVIEGPYIMTLIHDFSEREYHGCLQLDSPTHINNGPYTL
LASNKYGQDRKTVDAHFMRNPFEGGTVTEPLYYDPTTDDTPLDPPEDRVAVYVVVGIAAV
AFTGFLLMLVMLKFGGNSKFGIKGASSVISNDDDSASPLHHVSNGSNTPSSSEMGPDAVM
IGMTKIPVIENPQYFRSNSMLKSDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLSPE
LDKILVAVKTLKEASENARKDFHREAELLTNLQHEHIVTFYGVCVESDPLIMVFEYMKHG
DLNKFLRAHGPDSVMMGDGPTNRPVELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRN
CLVGENLLVKIGDFGMSRDVYSTDYYRVSVGGHTMLPIRWMPPESIMYRKFTTESDVWSL
GVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPKEVYDLMLGCWQREPHMRHH
IKEIHSLLLNLAKASPVYLDILG
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggagggagccgagatgagcgcctttcggaggggtagtggggtgattctgttcgggttg
tgttgcgtactaatgggtctgtggaggctcggggccgcctgccccgcgtcctgctcctgc
agcgggaccaggatcacctgtgtggaccaggagcggggtatcatggctttccccgtgttg
cagtcggagctggagatggacaacattaccgacatatatattgcaaaccaaagtagcttc
tcgtccatcaatgacaaagacctgcattattaccggaacctcaccaatctaactgtgatt
aacagccggcttacctatgtgtctcgactggccttccagaacaacctcaagcttcagtat
ctgaatttgaaagacaacaacctgtcatctctgtcttggaggatatttcgacgtttaaac
atatcaaatctgattctttctgggaacccgctgcactgttcctgtgagaacatatggatg
aagctatggctgggagaggaggccgatgctcaggacctccaatgtacagcggagggtggc
gggaggaaacccctgatcaggctcaaactccctcactgcatggttcccatggcgactctg
agcccgtccaaggtgatggtgcaggagggtgctgatgtggtgctgacatgcaacacctct
ggagagccctctcctgagctcatctggaaaatgaccccactcatctcctactatgagatt
gagacctcaggccaagtgtctgagctccatctctataacctctcctccctggacaacaac
tgtaagatcacctgcagtgctgggaacattgtgggcgagaatgagtccaccgtcctcctc
aacatcctctttccccctaacatcagtaagttgagtgatgcctaccaggaccaccactgg
tgcatcccattcagtatgtctgggaacccaaagcccgagctccgctggctgttaaacggg
gagccggtcattgagggaccctacatcatgaccctaatccatgacttctctgagagggag
taccacggctgcctgcagctggacagccccacacacatcaacaacggaccgtacactctg
ttggccagcaacaagtacggacaggaccgcaagaccgtcgatgcccacttcatgcgcaac
ccctttgagggaggaacagtgacagaacctctttactatgacccgactacagacgacaca
cctctagatccaccggaagacagagttgctgtatacgtggtcgttgggattgcagcagta
gccttcacgggtttcctcttgatgctggtcatgctaaaattcgggggaaactcaaagttt
ggaatcaaaggtgcatcgtctgtgatcagcaatgatgacgactcagcctctcctctccac
catgtgtccaacggcagtaacactccgtcctcctctgagatgggcccagacgccgtcatg
atcggcatgaccaagatccccgtcatcgagaaccctcagtacttccgcagcaacagcatg
ctcaaatcagacacctttgtccagcacatcaagaggcacaatatagttctgaagagggag
ttgggagaaggggcgtttggcaaggttttcctggccgagtgctataacctgtctcctgag
ctcgacaagatcctggtggctgtcaagaccctgaaagaggccagtgagaatgcgaggaag
gacttccatcgagaagccgagttgctgaccaacctgcagcacgagcatatcgtcaccttc
tacggtgtgtgtgtggagagcgaccccctcatcatggtgtttgagtacatgaagcacggg
gacctcaacaagttcctcagggctcatggtcccgactctgtgatgatgggtgacggtccg
acaaaccgacccgtggagctgacccagtcccagatgctgcacatcgcccagcagatcgct
gcaggcatggtctacctggcctcccagcactttgtccaccgagacctggccacacgtaac
tgtctggtgggagagaacctgctggtgaagatcggtgacttcggcatgtcccgagacgtg
tatagtacggactactacagggtaagtgtgggcggtcataccatgctgcccatccgctgg
atgcctccagagagcatcatgtacaggaagttcaccacagagagtgatgtgtggagtctg
ggcgtggtcctctgggagatcttcacctatggcaaacagccctggtaccagctctccaac
aacgaggtaattgagtgcattacacaggggcgtgtcctgcagcggcctcgcacctgtccc
aaagaggtgtacgacctgatgctggggtgctggcagagagagccccacatgagacaccac
atcaaggagatccacagcctactgctaaacctagccaaagcctctcctgtctacctggac
atcctgggctga

DBGET integrated database retrieval system