KEGG   Salmo salar (Atlantic salmon): 106581277Help
Entry
106581277         CDS       T04363                                 

Definition
(RefSeq) retinal guanylyl cyclase 2-like
  KO
K12322  guanylate cyclase 2F [EC:4.6.1.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00230  Purine metabolism
sasa01100  Metabolic pathways
sasa04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106581277
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    106581277
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106581277
Enzymes [BR:sasa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     106581277
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   106581277
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase Peripla_BP_6 HNOBA Kinase-like PspB
Motif
Other DBs
NCBI-GeneID: 106581277
NCBI-ProteinID: XP_014018711
UniProt: A0A1S3NU21
Position
ssa20
AA seq 1109 aa AA seqDB search
MQHIPLNVRGVLWDLSNYPYGPIFKSRHSLATLPFYNFLLWVLLGVLTFPCCVQCLIFKV
GVLGPWNCDPVYSKALPALAAKLAVGRINEDFSLDLGSKLDFVILQEACETSKALTTFVY
YEKMVDGFVGPTNPGYCDAASLLGKNWDKAIFSWACINYELDRIKSYPTFARTLPSPTRV
LFTVLKHFSWANIGIVSSNEDIWIDTAGKAANSLRSQGLPVGIVESVGMNETEMESTLSR
IQAAGEIKVIIMCMHSALIGGEQQTAFLLKAHEMGLTKGRYVFVPYDTLLYSLPYANTSY
FPLQNNTKLRQAYDAVLTITVSSDLMSFNEAFNMAKRFEELTISLVPQQVNPLFGTIYNG
IYLLAKAMHNARRAGQWLSGTNLAYFTRNMTFSGFNQKIQIDTEGESQTNYVILDSDGWE
GQLYRSYLVDLSSDMVRFAGKSIHFPGGSPPPSDSSCWFEPNTICTGGVEITFVIVVVVI
IFILIVGGLGLSLFVRRRIQQIQLVKGPNRILLTLEDLTFINPQLSKRKITLEDLGDSKS
AIDNNSMHSGDPHHSVNSITTATHDTTNVAVYEGDWVWLKKFEEGHFKEVKQSTTKIFTK
MKDLRNENINPFLGFFTDCDMFAVVTEHCSRGSLQDLLRNDDVKLEWMFKSSLLLDLIKG
MKYLHHREFPHGRLKSRNCVVDGRFVLKITDYGFNELLESQKSPQNIVPPEDQFWTAPEF
LRDMENSRKGTYKGDVYSFAIILQEVVVRGLPYCMLGLTPAEIIRKVKKPPPMCRPTVAP
DQAPLECIQLMKQCWSEQPDRRPAFDEIFDQFKLINKGKKTNIIDSMLRMLEQYSSNLED
LIRERTEELEVEKQRTEKLLSEMLPPSVAEALKTGATVEPEYFDQVTIYFSDIVGFTTIS
SLSDPIEVVDLLNDLYTLFDAVLSNHDVYKVETIGDAYMVASGLPKRNGNKHAAEIANMS
LNILSSVGTFQMRHMPGMPVRIRIGIHSGSCVAGVVGLTMPRYCLFGDTVNTASRMESTG
LPYRIHVNMSTVKILRSLNEGYKIDVRGMTELKGKGIEETYWLVGKENFTKPLPNPPEIK
PGDNWQEMVTDEIKTIFRKANREVDKPKI
NT seq 3330 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatattcctctaaatgttagaggtgtgctatgggacttatccaactatccctat
ggccccatcttcaagagcagacacagccttgcaactctgccattctataactttctgcta
tgggtcctgctcggggttttgacgtttccatgctgtgtccagtgtttaatcttcaaagtt
ggggtccttgggccctggaactgcgacccggtctactccaaggccctacctgcgctggcc
gctaaactggccgtgggcagaataaacgaggatttcagtttagatttgggcagcaaattg
gactttgtgatcctgcaagaagcatgtgaaacgtctaaagcattgacaacatttgtgtac
tacgagaagatggtggacggtttcgtcggacccacgaatccaggatactgtgacgcagcc
tcacttttgggcaaaaactgggataaagcgatcttttcctgggcttgtattaactatgag
ttggatcgaatcaagagctacccaaccttcgctcggacactgccgtcacccacacgggtg
ttgttcaccgtgttgaagcatttcagttgggccaacatcggcatcgtgtcttccaatgag
gatatctggatagacaccgccggtaaagcggccaactccctgcggagccagggacttccc
gttggcatcgtagagtcggtgggaatgaacgaaacggagatggaaagcacactgagcaga
atccaggctgctggagagatcaaagtgatcatcatgtgcatgcactctgctctgattggt
ggggagcagcagacagccttcctgctgaaggctcatgagatgggtctgacgaagggccgc
tacgtgtttgtcccctatgacaccctgctctacagcctgccctacgccaacacatcctac
ttccccctgcaaaacaacaccaagctgcggcaggcctacgacgccgtgctcaccatcacc
gtgtcctcagatctgatgtcattcaacgaggcattcaacatggccaagaggtttgaggaa
ctcaccatatcactggtcccacagcaggtcaatcccctgtttggaaccatctacaatggt
atttacctccttgccaaagccatgcacaatgccaggagagctggccagtggctctctggg
accaacctagcttatttcaccaggaacatgacgttctctggcttcaaccagaagatccag
atagacactgaaggggagagccagaccaactatgtcatcctggactccgacggatgggag
ggtcagctgtaccgctcctatctggtggacctgagctctgacatggtccgcttcgcaggc
aaatccattcatttccctgggggttcccctcccccctcagactccagctgttggtttgaa
ccaaatacaatctgcactggaggtgtggagataaccttcgtcatagtggtggttgtgatc
atcttcattctgatcgtgggaggacttggtctaagtctgttcgtaaggaggagaatccag
cagatccagttggtgaaggggcccaatcggatcctactgactctagaggacctcacgttc
atcaaccctcaacttagcaagaggaaaatcactctagaggacctgggtgactctaaaagt
gcaatagacaacaacagtatgcattcaggagatccgcaccactctgtgaacagcatcact
accgcaacacatgacaccacaaatgtagctgtctatgagggcgactgggtgtggctgaaa
aagtttgaagaaggccatttcaaggaagttaagcagagcaccaccaagatctttacaaag
atgaaggatctgcgaaatgagaacatcaatccgttcctggggtttttcacagactgtgac
atgtttgccgtggtgacggagcattgttcccgtggcagtctgcaggacctcctgaggaac
gacgatgtcaagctggaatggatgttcaagtcttctctgttgctggacctaatcaagggt
atgaagtatctgcaccatcgagagttccctcacggccggctgaagtcacggaactgtgtg
gtggacggtcgcttcgtcctcaagatcacagactacggctttaacgagctgctggaatcc
cagaaatccccccaaaatatagttccacctgaagatcagttttggacagctccagagttc
ctccgagacatggagaactctcggaaggggacctataaaggagatgtgtatagttttgcc
attatactccaagaggtggttgtccgaggacttccatattgcatgctgggtctgactcct
gcggagatcatccgtaaggtgaagaagcctcctcccatgtgcaggcccacggtggcccca
gatcaggctcctctggagtgtatccagctgatgaaacagtgctggagcgaacagcctgac
cgcagaccagccttcgatgagatctttgaccagttcaagctgatcaacaagggcaagaag
accaacatcattgactccatgttgcggatgctggaacagtactcatctaacctggaggac
ctgatcagagagaggacagaggagctggaagtggagaaacagaggacggagaaactgctg
tctgagatgctgcctccttctgtggcagaggctctaaagacgggtgcgacggtggagcca
gagtactttgaccaggtcaccatctacttcagtgacatagtaggcttcaccaccatctcc
tccctcagtgatcccatcgaggtggtggacctgctcaatgacctgtacacgctgttcgat
gctgtgctcagcaaccacgacgtatacaaggtggagaccattggtgacgcctacatggtg
gcatcaggtctacccaagaggaatggcaacaaacacgcagcggagatagccaacatgtcc
ctgaacatcctgagctctgtgggcaccttccagatgcgccacatgcccggcatgcccgtc
aggatacgaatagggatacactcagggtcatgtgttgctggggtggtgggtctgaccatg
cctcggtactgcctttttggagacacagtcaacactgcctctcgtatggaatccacaggg
ctgccttatagaattcatgtgaacatgagcactgtgaagatcctgcgctccctcaacgag
ggctacaagatagacgtcaggggcatgacagagctgaagggtaaaggcattgaagagaca
tactggctggttgggaaagaaaacttcacaaagcctttaccgaaccctccagagattaaa
ccaggggacaactggcaagagatggtgacagatgagatcaagacgatatttcgcaaggcc
aaccgggaggtggacaagcctaaaatctga

DBGET integrated database retrieval system