KEGG   Salmo salar (Atlantic salmon): 106582016Help
Entry
106582016         CDS       T04363                                 

Definition
(RefSeq) uncharacterized LOC106582016
  KO
K23310  PHD finger protein 6
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106582016
   03009 Ribosome biogenesis [BR:sasa03009]
    106582016
   03036 Chromosome and associated proteins [BR:sasa03036]
    106582016
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Zinc finger
   Cys4HisCys3 PHD fingers
    106582016
Ribosome biogenesis [BR:sasa03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   106582016
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Chromatin remodeling factors
   NuRD complex
    106582016
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 106582016
NCBI-ProteinID: XP_014020130
UniProt: A0A1S3NXY0
Position
ssa21
AA seq 504 aa AA seqDB search
MGPERHGGKIRCVLCKGSEENLTTGPLSTKDSVTAHQNCLLYSSGIICQNSPELDDLFGF
TVKDVQNEMRRGNRLICYRCKRKGATVGCEVKCCQKSYHYPCAVGDGAHNVEDRIAGKYT
VYCQKHNPELAASNGTALSCNSDSDTEKNNNGETSSKQFCLICEKKEESISLEHIDSGIF
KLYCEKHKPLSLQKELNGPSSCKSDSNTPENQRQTQTPKRRLSFSRKQKVTSSRKSKHRR
ILDNSSDSDGDVNRIDMEFSPLESNLEDRVNSEHSNHVETPIASTTGNQPAPEDGDSTSI
DSDAGSQSLLLPVMLCVASEEPSGAIGSVPHSPGSPHGSSHSPEPAHDPISPVHSPDCSS
VHSGPLNITSTAIVCYGPVSSPSPSTPSPHSVSQCPLARPGGPGSPGGSGSGNAASKVFW
RRCNEAGCTESIFTTFISDMVGISKRILSDQASQEDYDLSLRVIEASGKLSKMLSQQKRA
FQKKQMELQRATAAIREARSALKR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgggtcccgagcgtcatggtgggaaaatacgatgcgtactttgtaaaggttccgaggaa
aatctgacaactggaccgctatcgacgaaagattccgtcaccgctcatcagaactgcttg
ctttattcatctgggattatttgccagaactctccagagcttgacgacttgtttggtttc
actgtaaaagatgtccagaatgagatgaggaggggaaaccgactgatttgctacaggtgt
aagaggaagggtgccacggtggggtgtgaggtgaaatgctgtcagaagtcctaccattac
ccctgtgctgtgggagacggggcccacaacgtcgaagaccgtattgcagggaagtatacg
gtgtactgtcagaagcataatccagagttagcagcatccaatggtacagctttgtcctgc
aacagtgattcagacacagagaagaacaacaatggagaaacgtcatccaagcagttttgt
ctcatctgtgaaaagaaagaagagagcatcagtctagaacacatcgacagtggcattttc
aagttgtattgtgaaaagcataaaccactgtcgttgcagaaagagctgaatggaccctca
tcttgcaagagtgactccaacacgcctgaaaaccaacggcagacacaaacacccaagaga
cggttgagcttctctaggaaacagaaagtcacatcatcaagaaagtccaaacacaggagg
atactggataactcctcagactcagatggagatgtgaataggattgatatggagttttcc
cctctggagtccaatctagaagaccgtgtcaactctgaacacagtaatcatgttgagacc
cccatagcttccaccacaggaaatcagccagcacctgaagatggggactctacatccatc
gactcagatgctgggtcccagagtcttttgctgccagtgatgctgtgtgttgcatctgaa
gaaccctctggggccataggttctgttccgcactcacctggttcaccacacggcagctct
cactcacctgaacctgctcatgatcccatctcgcctgtccactcacctgactgctcgtcc
gtccactctggtccactcaatatcaccagcacagctattgtgtgttatgggccagtgtcc
tctccatctccctctactccctctccacactccgtctcccagtgtcccctggcaagacct
ggaggcccgggttcacctggtggttctggctccggcaatgcagccagcaaggtgttctgg
aggaggtgtaacgaagcaggctgtacagagtccatcttcaccaccttcatctctgacatg
gtcggcatctccaagaggatcctgtcagatcaggccagtcaggaggattatgatctctct
ctgagagtgattgaggcctctggaaaattatcaaagatgctttcacagcagaagagagcg
tttcagaagaagcaaatggagctacagagagctacggcagccataagagaagccaggtca
gccctgaaaagatga

DBGET integrated database retrieval system