KEGG   Salmo salar (Atlantic salmon): 106582088Help
Entry
106582088         CDS       T04363                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 4-like
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa03410  Base excision repair
sasa04210  Apoptosis
sasa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    106582088
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106582088
   04217 Necroptosis
    106582088
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sasa03032]
    106582088
   03036 Chromosome and associated proteins [BR:sasa03036]
    106582088
   03400 DNA repair and recombination proteins [BR:sasa03400]
    106582088
Enzymes [BR:sasa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     106582088
DNA replication proteins [BR:sasa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     106582088
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    106582088
DNA repair and recombination proteins [BR:sasa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     106582088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VIT PARP VWA_3 VIT_2 VWA BRCT_2 VWA_2 BRCT PTCB-BRCT
Motif
Other DBs
NCBI-GeneID: 106582088
NCBI-ProteinID: XP_014020296
UniProt: A0A1S3NYE6
Position
ssa21
AA seq 2070 aa AA seqDB search
MDKSTYKSMAPFDNCFVVLELKTLPYKEKKRLKLAITENGGSISYVINKQCTLVVTISMS
SLSASRVRSIKKHQTPVVGVEYVSRCLEKGVLLPVEDYCLPPPPSTSLIPPRPASPLPSL
SVLKGTSQPAEVQIQTVNAVNQAESAGNQERTYLGKFRVYTESDNDLPTYPTNFQVAKYS
IFGKANSSTWSVLELQSGSTEGGQQQYRVVRYWREDHGAKSAAVQDKQVFLSMSEEAVEV
YQTLRKELQVRGLTLRTTLPPEAPYLGSASLQQLLLEEKLSCSSLSQEVGVFVELLWAEA
LGCLDNVLKVPITSLSLNDVSRAEGLLLQVQRKLRARQGEGPDTEVASLMEEVYTLLPHK
TDQSHLPLHTKLISSQLDLCQLIRDVLNVSEATLRSPIPSCLGKYRALRCSIERVPPGPE
LLYVTELLQDRQVQILQVLRVNRGVELQMFREDLGNVKPLLHSSSPSSFVGILSRGLLLP
RVGVEHHGIERTDIGNLGGGIYFSDAMSTSLKYSKPSVTDGSRLLLVCDVALGRCTDLQK
RDSSLTRSPEGYHSVHGVRHTPKKPSEFDDDEYVVYSPEQVRLQYMVQFRLEEDQLKDFQ
PTIDTSSTELPLPVSPSDLLSCGEAEEDVGSCKNPLEEVTAGLLDCSGQPLPLQAVHVRA
RLMDLLSQVIIFQTYTNQSTAPIEAKYVFPLDDSAAVCGFEAFINGKHVMGQVKEKQQAR
KEYKQAIERGHGAYLMDQDAPDVFTISVGNLPAGATVLIKVTFVTELVVMEGLINFSLPG
SVAPWQQSSALNQRTQVTLEKVCVTNLDSQGEFSLDMSIEMPNEIINLHCLTHKVKIKRT
DCKAVVRTCPGETLGPDGFLVCFSLAQIHLPRMWVEKHPDKDSQACMLVFYPDFEPCPTS
SPMSGSSEVILLLDSSESMRGDALQNARRIALQFVNTMDHHSVRVNVISFGSDQKDAFLS
ANPLVEALQPAKKFIMSSPPVGGSTELWRPLRSLSLLPPSQGVRNLLLLSDGHVQNQALT
LQLVRQHAQHSRLFTCGLSPTANRHMLRALAQAGGGAYEFFDTKTKHTWREKVACQVKRI
MSPGCSSVSVKWQQFNPSAPPPVQAPSQLHALFTDCHTLVYGFVPHCTQATLLGDLSGQN
IETMVSTTELQKTRGTFLHKLTARAVIRDYEDGSLHTNEAEHEGKKSVMKSFIIELSKEF
SILSQFTSFVAIEERDSEQPDVVFTDVPKLISDEDVDFLPYLSWLEEEYEGDGMDLGSNS
MSNLLDGGPGRVLCRNICMEEMVMGEEHESLVQLQVDDESWEGLNYSYLMGSMVFGSPVT
VSAATKPPDMTLKSEGAVTDEEMECFNDMYFGLQESEHPLRGSVIMHSEALTSFYSPTLH
TITGSQSTPVTPYLATKMLAMTVETDFIPELSETIQSLPEIVRHAKSRQGDFRRADRHRK
VCADPAFDTVETQKKSLSVADVPRPPPSVLQLKSCAVADALLPPPASVVGSPGPPPPPAS
VLSSPGPPSRLQSFSSAVSDALPPPPPASVLSSPGPPPSRLQSFSAAVSDALPPPPPAFV
LSSPGPPPSRLQSFSATVSDALPPTPPASVLSSPGPPPSRLQSFSATVSDALPPPPPAFV
LSSPGPPPSRLQSFSATVSDALPPTPPASVLSSPGPPPSRLQSFSDAVSDSLPPPSALVS
NEFRAIRHKMRGHPKPGVGAISHTATFPKLQAGKDLLLSKPREPYPVELCETSKMWTVDN
SLSEDKDCGLVEMDHWQPSVVPASVPPSGFSFGGGRVGSQSSQHHGSWFGDTANACYIPG
LFEASSAGSLFGPTLPYLGSSGRSMGLSFEAPLTGGHLNSPLPTTHGFNLTHPLGASLGS
SLFGSSLRTLQQHHVLPQAQKPLDIKKNIQKLVGDSERREGLEFRKNTLDVVKWTEIFAL
QHSEGYWECSASLGSLLGVDVDYFANVFLKNRGISSLGVRAHADILRLVASLLVLQLMRV
RRLEEGKLLLSLFRLDLDHSPPQPRCERWEAVRRAVDWVCWADREYPCVCSRLEFGWDWE
SSTRQLLGIDPPHPLSPLILLGTTGGVRAQ
NT seq 6213 nt NT seq  +upstreamnt  +downstreamnt
atggataagtcaacatacaagtctatggctccgtttgacaactgttttgtggttttggag
ctgaagactttgccttataaggagaagaagaggctgaagctggcaataacagagaatggg
ggcagcatttcctatgtgatcaataagcagtgtactctcgtagtgacgatcagtatgtcc
agtctgagcgccagtcgggtgcggagcataaagaagcatcagactccagtagtaggggtg
gagtatgtgtcacgctgcctggagaagggagtcctgctgcctgtagaggactactgcctg
cccccccctccctctacctctctcatcccccccaggcctgcctctcccttgccatctctg
tcagttttgaaggggacgagccagccggctgaagttcagatccagacagtgaatgctgta
aatcaagccgagagtgcggggaatcaggagagaacttacctgggcaaattcagagtgtat
actgaaagtgacaatgatcttccaacatatccaacaaatttccaagtggccaaatactca
atttttggaaaggctaacagcagcacatggtcggtgttggagctgcagagtggcagcaca
gaggggggacagcagcagtaccgtgtggtgaggtactggagagaggaccatggtgccaag
tcagcagctgtgcaggacaagcaggtgttcctctccatgtcagaggaggctgtggaggtc
taccagactctcaggaaggagctgcaggtcagaggactcacactcaggaccaccctccct
ccagaggctccgtatctgggctctgccagcctgcagcagctgctgctggaggagaagctg
agttgcagcagcctatcacaggaagtgggcgtgttcgtggagctgctctgggcagaggcc
cttggttgtctggacaacgtcctcaaggttccaatcaccagcctcagtctcaacgatgtg
agcagggctgaggggctgctgctacaggtccagaggaagctgagggcgagacagggggag
gggccagacactgaggtggcttctctgatggaggaggtctacaccctcctgccacacaaa
actgatcagtcccatctccctctccacactaaactcatctcatcgcaactggacctctgc
cagttaatcagagacgtgctgaatgtgagcgaggcaacactgagaagccccatcccttcc
tgtctggggaagtaccgcgcgctgaggtgcagcattgaaagagttccccctggtcctgaa
ttgctgtatgtcacagaacttctacaggacagacaggtgcagatcttgcaggtgctgaga
gtaaacagaggggtagagctacagatgtttagagaggatctggggaacgttaagcccctc
ctccactcctccagccccagcagctttgtggggatcctgtctcggggtctgttgctgccc
agagttggagtggagcatcatgggattgagagaacagacattgggaacttgggcggtggc
atctacttcagtgatgcaatgagtaccagtttgaagtactctaagcccagtgtgacggac
ggcagtcggctgctgctggtgtgtgacgtggcgttggggcgctgtactgacctccagaag
agggacagcagcctgactcgctcccctgagggataccacagtgtacacggggttcgccac
acccccaagaaaccctcagagtttgacgatgatgagtatgtggtgtacagcccagagcag
gtgaggctgcaatatatggtacagttcagactggaggaggaccagctgaaggacttccag
cccaccatagatacttcttctaccgagcttccgcttcctgtctcaccgtctgacctcttg
tcctgtggtgaggctgaggaggatgttgggagctgtaagaaccctctagaggaggtgact
gcaggcctgttggactgctctggacaaccactccccctacaggccgttcatgtcagggcc
aggctgatggatctgctctcccaggtcatcatcttccagacatacaccaatcagagcacc
gcccccatcgaagccaagtacgtcttcccattggatgattctgctgctgtgtgtggcttt
gaggccttcatcaatgggaaacatgtaatgggacaggtgaaggagaagcagcaggcacgt
aaagagtataaacaggccatagagagaggccatggagcttacctaatggaccaggatgca
cctgatgttttcaccatcagcgttgggaacctgcctgccggtgccaccgtccttatcaaa
gttaccttcgtcaccgagctggtcgtcatggagggcttgatcaacttctcgttgcccggt
agtgtggcgccatggcaacagagctcagcgctcaaccagaggactcaggtgactttggaa
aaggtgtgtgtgaccaacctggattcccaaggggagtttagtctggacatgtccattgag
atgcccaatgagatcatcaacctgcactgcctcacacacaaagtcaagatcaagaggacc
gactgtaaggcggtggtgaggacatgtccaggtgagactctgggtccagatgggttcctg
gtctgcttcagtctggcccagatccacctacccaggatgtgggtggagaaacatccagat
aaagacagccaggcctgtatgttggtattttacccagactttgagccctgccccacctcc
agccccatgtccggctccagtgaggtgatcctgctgttggactcgtctgagtccatgaga
ggagacgctctccagaacgccagaagaatcgccctgcagtttgttaataccatggaccac
cacagcgttcgagtcaacgtcatctcctttggctcagaccagaaggatgcttttctctcg
gccaaccctctagtcgaggctctccaaccagccaagaagttcatcatgtcctccccacct
gttgggggcagcactgagctgtggaggcccctgcgcagcctgagtctgttgcctccgtca
cagggcgtgaggaacctgctgctgctatcagacggccacgtccagaaccaagccctgacc
ctgcagctggtcagacagcatgcccagcacagccgcctcttcacctgcggcctcagccca
acagccaatcggcacatgttgcgggccctggcccaggcagggggaggggcctatgagttc
tttgacacaaagacaaagcacacctggcgggagaaggtggcgtgccaggtgaagcgcatc
atgtctccaggctgcagctctgtgtctgtgaagtggcagcagtttaacccctcagctccc
cctccggtccaggccccctctcagctccacgcgctcttcactgactgccacaccctggtc
tacggcttcgtgccacactgtacacaggccactcttcttggagacctgagtggtcagaac
attgagacaatggtgtccaccactgagctacagaaaaccaggggcacgttccttcataag
ctcacagcgagggctgttatcagagactatgaggatggcagtcttcacaccaacgaggct
gaacatgaggggaagaaatcagtgatgaagtccttcatcattgagctgagcaaagagttc
tccatcctgtctcagttcaccagctttgttgccatcgaggagagggactcagagcagcct
gacgtggttttcacagacgttcccaaactgatctcagacgaggacgtcgacttcttacct
taccttagctggctggaggaggaatatgagggagatggaatggacttgggatcaaactca
atgtcaaacttgctggatggtgggccagggcgtgttttatgcagaaatatctgtatggag
gagatggtgatgggggaggagcatgaatcgttggttcaactccaggtggatgacgaatca
tgggaaggacttaattactcttacttaatgggctctatggtctttggcagcccagtgacc
gtgtccgctgctaccaaacctccggatatgactttgaagagtgaaggagctgtgacggat
gaagagatggagtgctttaatgacatgtactttggtttacaggaatctgaacaccccctt
cgtggctcagtaatcatgcatagtgaggctctgacctctttttactctccaactctccac
acgattacaggtagccaaagcacaccagtcaccccataccttgctaccaaaatgctggct
atgactgtggagacggatttcatccctgagctgtctgagaccatccagtctctcccagag
atagtgaggcatgcgaagagtagacagggagactttagacgggcggacagacacaggaag
gtttgtgccgatccggcatttgacactgtagagacacagaagaagtctctctctgttgct
gatgtgcctcgtcctcctccctctgttcttcagctcaagtcttgcgctgttgctgatgct
ctccttccaccccctgcttctgtcgtcggttctcctggtcctcctccaccccctgcttct
gtcctcagttctcctggtcctccatctcgactgcagtctttctcttccgcagtttcagat
gctcttcctcctccaccccctgcttctgtcctcagttctcctggtcctcctccatctcga
ctgcagtctttctctgccgcagtttcagatgctcttcctcctccaccccctgcttttgtc
ctcagttctcctggtcctcctccatctcgactgcagtctttctctgccacagtttcagat
gctcttcctcctacaccccctgcttctgtcctcagttctcctggtcctcctccatctcga
ctgcagtctttctctgccacagtttcagatgctcttcctcctccaccccctgcttttgtc
ctcagttctcctggtcctcctccatctcgactgcagtctttctctgccacagtttcagat
gctcttcctcctacaccccctgcttctgtcctcagttctcctggtcctcctccatctcga
ctgcagtctttctctgacgcagtttcagattctcttcctcctccctctgctcttgtctcc
aatgagtttcgagcaattagacacaagatgagaggtcatcccaaacctggagttggggct
atctcccatactgctaccttcccgaaactgcaagccggtaaggacctgctactttccaaa
ccccgagagccctatcctgtggaactgtgtgagactagcaaaatgtggaccgtggataat
agcttatctgaggataaggattgtggactagtggagatggaccactggcagccttctgtt
gtccctgcctctgtgcccccatcagggtttagtttcgggggtgggagggtagggtctcaa
agcagccaacatcacggctcttggtttggggacacagccaatgcatgttacattccaggt
ttatttgaggcttcttcagcaggctcgctgtttggccccacactcccttatcttggaagc
tcgggcagatcaatggggttaagttttgaggcaccacttactggcggacacctcaactcc
cctttacccaccactcatggcttcaatctgacccatcctttaggggcctcacttggttcc
tctctgtttggtagctctctcaggacactacaacaacatcatgtactaccacaagcacaa
aaacctctggatataaaaaaaaacatacagaaacttgtcggagacagtgaaaggagggaa
ggtcttgaattcaggaagaatactcttgatgtagtaaaatggacagagatttttgccctc
cagcactcggaaggttactgggagtgctctgccagcctgggttccctcctcggtgtggat
gtggactattttgcaaacgtcttcctgaagaatagaggcatcagctctctaggtgtgagg
gcccatgctgacatcctgaggctggtggccagtctgctggtgctgcagctgatgagggtg
aggaggctagaggaggggaagctgctgctcagcctgttccgtctggacctggaccactct
cctcctcagcccaggtgtgagcgctgggaggcggtgaggagggcggtggactgggtgtgt
tgggcagacagggagtacccgtgtgtgtgcagcaggctggagtttggctgggactgggag
tcgtccacacggcagctcctgggcatcgaccccccacaccccctctctcccctcatcctc
ctcgggaccacagggggagtgagggcccaatga

DBGET integrated database retrieval system