KEGG   Salmo salar (Atlantic salmon): 106582376Help
Entry
106582376         CDS       T04363                                 

Definition
(RefSeq) isocitrate dehydrogenase [NADP] cytoplasmic-like
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00020  Citrate cycle (TCA cycle)
sasa00480  Glutathione metabolism
sasa01100  Metabolic pathways
sasa01200  Carbon metabolism
sasa01210  2-Oxocarboxylic acid metabolism
sasa01230  Biosynthesis of amino acids
sasa04146  Peroxisome
Module
sasa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sasa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106582376
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106582376
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106582376
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     106582376
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 106582376
NCBI-ProteinID: XP_014020908
UniProt: A0A1S3NZU3
Position
ssa21
AA seq 428 aa AA seqDB search
MLGAPDRLRFGGSRMSQKIKAGSVVEMQGDEMTRVIWELIKEKLIFPYLEMDLHSYDLGM
ENRDATDDKVTVEAAEATRRYNVGIKCATITPDENRVEEFKLKQMWRSPNGTIRNILGGT
VFREAIICKNIPRLVPGWVKPIIIGRHAHGDQYKATDFVVPGPGRLEMKFTPKIGEPMNF
VVHDFEGSGGVALGMYNTDNSIRDFAHSSFQMGLQKAWPLYLSTKNTILKKYDGRFKDIF
QEIYEKQYRSKFEQKGIWYEHRLIDDMVAQAMKSDGGFIWACKNYDGDVQSDSVAQGYGS
LGMMTSVLICPDGRTVESEAAHGTVTRHYRQHQQGKETSTNPIASIFAWSRGLLHRAKLD
DNAELRVFAEALEVVCVETIEAGFMTKDLAICIKGMAGTKRSDYLNTFEFLDKLSENLKT
KMSNQPKL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgctcggtgcgccagatcgactacggtttggaggttccaggatgtcccagaagatcaag
gcaggttcggtggtggagatgcagggggatgagatgaccagagttatctgggagctcatt
aaggagaagcttatcttcccctacctggagatggacctgcacagctacgacctgggcatg
gagaaccgcgatgccacagacgacaaggtgactgttgaggcggcggaggcgacgcggcgc
tacaacgtgggcattaagtgtgccaccatcacgccggatgaaaaccgggtggaggaattc
aagctaaagcagatgtggcgctcgcccaacgggaccatccgtaacatcctgggaggcacc
gtgttcagggaggccatcatctgtaagaacatcccccgcctggtgcccggctgggtcaaa
cccatcatcatcggcaggcatgctcacggagaccagtacaaggccacagactttgtggta
cctggacctgggagactggagatgaaattcacacccaaaattggggagccaatgaacttt
gtggtccatgactttgaaggttcaggtggtgtggctctgggaatgtacaacacagacaac
tccatcagggactttgcccacagctccttccagatggggctgcagaaagcctggcctctg
tacctcagcaccaagaacaccatcctcaagaagtacgacggacgcttcaaagatatcttc
caggagatctatgaaaagcagtaccgctctaagtttgagcagaaggggatctggtatgag
catcgtctgattgatgacatggtggctcaggccatgaagtctgatggtggattcatctgg
gcctgcaagaactacgacggagacgtccagtctgactctgtagcccaaggttatgggtcc
cttggtatgatgaccagtgtgctcatctgtcctgacggtcgtacggtcgagtcagaggcg
gcccacggcacggtaacacgccactacagacagcaccagcagggcaaggagacatccacc
aaccccatcgcgtccatctttgcttggtcgcgggggctgctgcaccgggcgaagctggat
gacaacgcagagctgcgtgtgtttgctgaggccctggaggtcgtctgcgtcgagaccatc
gaggctggcttcatgaccaaggatctggccatctgtatcaaaggcatggcaggtaccaaa
cgctcagactacctgaacacctttgagttcctggataaactgtcagagaacctgaagacc
aagatgtccaaccaacccaaactgtga

DBGET integrated database retrieval system