KEGG   Salmo salar (Atlantic salmon): 106582389Help
Entry
106582389         CDS       T04363                                 

Definition
(RefSeq) NEDD8-conjugating enzyme UBE2F-like
  KO
K10687  ubiquitin-conjugating enzyme E2 F [EC:2.3.2.23]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106582389
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     106582389
Ubiquitin system [BR:sasa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   106582389
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con DUF2267
Motif
Other DBs
NCBI-GeneID: 106582389
NCBI-ProteinID: XP_014020931
UniProt: A0A1S3P080
Position
ssa21
AA seq 185 aa AA seqDB search
MLTLASKLKRDEGVKTGRPPGGPSDSSHRVSIRDRLLIKEVAELEANLPSTCKASFPDEN
KLHHFQLAVSPDEGYYQSGTFHFEIDVPEAYNMVPPKVKCQTRIWHPNIAETGEICLSLL
REHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIDAAEHHLRDKEDFRNKVQDYI
KHYAR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgttggccagtaagctgaagagagacgagggggtgaagactggccggccccct
gggggcccctccgactcctctcacagggtctctatcagggaccgactgctcatcaaagaa
gttgcagaacttgaagccaacctccctagtacgtgtaaagccagcttccctgatgagaac
aagctacaccactttcagctggctgtctctccagatgaaggctactaccagagtggaacg
ttccattttgaaatagacgtccctgaagcctacaacatggtgcctcccaaagttaaatgc
cagaccagaatatggcaccccaacattgccgagacgggggagatctgtttgagtttgttg
cgggagcactctatcgacggcacgggctgggcccctaccagaacgttaaaggatgtagtc
tggggattgaactccttgtttaccgatctacttaactttgatgacccattgaacattgac
gcggccgagcatcatctgcgtgataaggaggatttccggaataaggttcaggattacatc
aagcactacgccaggtga

DBGET integrated database retrieval system