KEGG   Salmo salar (Atlantic salmon): 106582833Help
Entry
106582833         CDS       T04363                                 

Definition
(RefSeq) ras association domain-containing protein 5-like
  KO
K08015  Ras association domain-containing protein 5
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    106582833
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RA Nore1-SARAH C1_1 C1_2 Ras_bdg_2 Zf_RING zf-HC5HC2H PHD
Motif
Other DBs
NCBI-GeneID: 106582833
NCBI-ProteinID: XP_014021799
UniProt: A0A1S3P2G7
Position
ssa22
AA seq 563 aa AA seqDB search
MASVSVVGPGQHRPAPDHQLVFHKLKAAGRNKITLPWKSSVEIILGESSVTRECGSVSAV
SAVKGSPLNPSLTPGQQGAAAGVRGGDPGVRCEAQPGLVTRNSDRESDSSSPACGDTEGD
TTAAREDTGQSGRSGSGNDSTRDRRSSLKILTNVMSSTSANTQMTDVKCDRSSAPTNGHM
GAHSHRDRPVRRRASHSPHGQTTGLVTKGDTGGPPLERLTQGRTGVVKLARTESHRREVW
SIFVSQEQEDARVRSETGEGHKFGTRTVTQDWCDVCNQRISAQQALKCKNCNYTCHQECG
GRVQLDCNQRDSNPQETTSPRRHCSTPPQYKQKEVEEDRGPKALSEEELRARIEDYNSMV
SENGMKLGADGLYTGFIKVHLRLSRPVTMLTMEWTGLDGQAERQGRPMTVSEGQEGAGAG
FSEKRTSFYLPSDCVKQIHISSTTTVREVIQGLLKKFMVQDNPRKFALYRQTHRDGQDLF
QKLPLVECPLALRLVVGPDPELLSFVLKENETGEVDWHAFSVPELQNFLVILEKEEAERV
RLVEQRFAVYRQSLQKALQEDQP
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagtgagtgtggtaggaccaggacaacatcgcccggctcccgaccaccagctc
gtctttcataaactaaaggccgccgggaggaataaaataacgttaccgtggaaatcctcc
gtggagatcatcctcggggagagctcggtgacgcgggagtgcggttcggtttcggcggta
tcagcagtcaaaggatccccactaaacccgtccctgaccccgggacaacaaggagccgca
gccggggtaagagggggggatcccggggtaaggtgtgaggctcagccggggctggtgaca
cgtaattcagacagagagagcgacagcagcagccctgcctgtggggacaccgagggagac
acgacagcggcgagggaggacactggtcaaagcggacggagcggcagcgggaatgactca
acccgtgatcgaaggagttccctgaagatcctcacaaatgttatgtcaagcacatcagct
aacacacagatgacagatgtcaagtgtgacagatcaagcgcgccaacaaacggacacatg
ggagcacactcacatcgggaccgtccggttagaaggcgcgcatcccacagcccccatggt
cagaccaccgggctggtgaccaaaggggacaccgggggaccgccgctggagcggttgaca
cagggaaggacaggggtcgttaaactcgcgcgcacagaatcccaccgaagggaggtctgg
tcaatatttgtctcccaggagcaggaggacgcgcgcgtgcggtcggagacaggagagggc
cacaagtttgggaccagaaccgtaactcaggactggtgcgacgtctgtaaccagcggatc
agtgctcagcaggcgctcaagtgtaaaaactgcaactacacctgtcaccaggagtgtgga
gggcgggtccagctggactgcaaccagagagacagcaacccacaggaaactacatctccc
agaagacactgctccacgcctcctcagtacaagcagaaggaggtcgaagaggacagaggg
cccaaggctctgtcagaggaagaattgcgggccaggatagaggactacaactctatggtc
tcagagaatggcatgaaactgggtgctgatggtttgtacactggcttcattaaggtccac
cttcgactaagtcgaccagtcacgatgctcactatggagtggacaggattagacggccag
gcggaaagacaaggtcggccaatgacggtgtcagaaggccaggagggggcgggagcaggg
ttcagtgagaagcggacgtcgttctacctgcccagtgactgtgtgaagcagatccacatc
agtagtactaccacagtcagggaggtcatacagggcctgctgaagaagtttatggtgcag
gataacccacgcaagtttgctctgtacagacagacacaccgtgatggacaagatctgttc
cagaagcttcctcttgtggaatgtcctctcgctctgagactggtggtgggtccagatcct
gagctgctcagcttcgtcctcaaggagaacgagaccggagaggtggactggcatgcgttc
tcggttcctgagctgcagaacttcctggtgattctggagaaggaggaggcagagcgtgtg
cgattggtggagcagagattcgcagtctaccgacagagcttgcagaaggcattacaggag
gatcaaccctga

DBGET integrated database retrieval system