KEGG   Salmo salar (Atlantic salmon): 106582961Help
Entry
106582961         CDS       T04363                                 

Definition
(RefSeq) delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial-like
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00250  Alanine, aspartate and glutamate metabolism
sasa00330  Arginine and proline metabolism
sasa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    106582961
   00330 Arginine and proline metabolism
    106582961
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     106582961
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 106582961
NCBI-ProteinID: XP_014022083
UniProt: A0A1S3P376
Position
ssa22
AA seq 556 aa AA seqDB search
MLRVRSAFYQSWRGFRTFPCAAVEVKNEPILGFNEGSPERAELQKALDDLKGKTEEIPCV
VGDEHVWTKDIRYQLSPFNHSHKLAKFCYADKELLNKAILASVAARREWDLKPIQDRAQV
LFKAADIISGPKRAEILAKTMIGQGKTVVQAEIDAAAELIDFFRFNAKHAVELESQQPLD
SDGSTNTMLYRGLEGFIAAVAPFNFTAIGGNLAGTPALMGNVVLWKPSDTAMSASYAVYN
VLRDSGLPPNIIQFVPADGPVFGDTITSSEHLAGINFTGSVPTFKRLWKQVAQNLDVYKN
FPRVAGECGGKNFHFVHKSADVQSVVTGTIRSAFEYGGQKCSACSRMYVPDSLWPQIKQG
LLDIHKQLKVGDPVEDWSTFFSAVIDDKSFARIKKWLDHAKSSPKLNIIAGGHCDDKKGY
FVEPTIIESTDPQEAIMAEEIFGPVLSVYVYPENDYLEVLHLIDNTSPYALTGAVFALDK
NVVNEAAKALRNAAGNYYVNDKSTGSIVAQQPFGGARASGTNDKPGGPHYVLRWTSPQVV
KATHVPLREWKYPYMG
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtgtgagatcagcattctatcagtcttggagggggttcaggaccttcccctgt
gcagctgttgaggtgaagaatgagcccatcctgggattcaacgagggcagtccagagagg
gccgagctgcagaaggccctggatgacctgaaggggaagacagaggagattccctgtgtg
gttggagacgaacatgtgtggaccaaagacatcagataccagctatcgcccttcaaccac
tctcacaaactggccaagttttgctatgctgacaaggagctgctcaacaaggctatcctg
gcctctgtggcggcacggagggaatgggacctgaaacccatccaggaccgagcccaggtc
ctctttaaggctgccgacatcatcagtggacctaagagagctgagattctggccaaaacc
atgataggccagggtaaaacagtggtgcaggcagagattgatgcagctgcagagctaata
gacttcttccggttcaatgcgaagcacgctgttgaactggagagccagcagcccctggac
agtgatggtagcaccaacaccatgctctaccgtgggctggagggtttcatagctgctgtt
gccccatttaacttcactgcaattggtggaaacctggcaggtacacctgctctcatgggt
aatgtagttctgtggaagcctagtgacacagccatgtcagctagctacgccgtctacaat
gtcctccgggattcagggttgccccccaacatcatccagtttgtgccggctgatggacca
gtatttggagacaccatcacctcctctgaacaccttgctggcatcaacttcactggcagt
gtccctaccttcaagcgcctgtggaaacaggtggcccagaacttggatgtctacaagaat
tttcctcgggtggcaggagaatgcggtggtaagaacttccattttgtgcacaagtcagca
gatgtgcagagtgtcgtgacagggaccatccgctcagcatttgagtatggagggcagaag
tgctcggcctgctccaggatgtatgtaccagactctctgtggccccagatcaaacagggg
ctcctggacatccacaagcagctcaaagtgggagaccccgtggaggactggagtacattc
ttctctgctgtgattgatgacaagtcctttgctcgtattaagaagtggttggaccatgcc
aagtcatcccctaagttgaacattattgctgggggccactgtgatgacaagaagggttac
tttgtggagcccaccatcattgagagcacagacccacaagaagccatcatggccgaggaa
atctttgggccagttctgtctgtctatgtttaccctgagaacgactacctggaagttctg
cacctgatagacaacacatcaccatatgccctgacaggagctgtctttgctctcgataag
aatgttgtgaatgaggcagccaaagccttgcggaacgctgccggaaattactatgtgaac
gacaagtccactggctctattgttgcccagcaaccatttggtggcgccagagcttcaggt
actaatgacaaacctggtggtcctcactacgtactgcgatggacatccccacaggtggtc
aaggccactcacgtcccgctccgagaatggaagtacccctatatgggttaa

DBGET integrated database retrieval system