KEGG   Salmo salar (Atlantic salmon): 106582996Help
Entry
106582996         CDS       T04363                                 

Gene name
kif17
Definition
(RefSeq) kinesin family member 17
  KO
K20198  kinesin family member 17
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sasa04812]
    106582996 (kif17)
Cytoskeleton proteins [BR:sasa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     106582996 (kif17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd Kinesin_assoc AAA_16 AAA_22
Motif
Other DBs
NCBI-GeneID: 106582996
NCBI-ProteinID: XP_014022163
UniProt: A0A1S3P3F7
Position
ssa22
AA seq 827 aa AA seqDB search
MASESVKVVVRCRPMNDREQILNCKMVVSVEMSRCQCLIKKPGAKEEPPKQFTFDGTYFI
GQTTEQMYNEIAYPLVEGVTEGYNGTIFAYGQTGSGKSFTMQGVSEPAAQRGVIPRAFEH
IFESIQCAENTKFLVRASYLEIYNEEIRDLLGNDTKQKMELKEHPEHGVYVRDLSLHTVH
SVGECERIMVQGWGNRSVGYTLMNKDSSRSHSIFTIHMEICNTDSAGEDHLRAGKLNLVD
LAGSERQSKTGATGERLREATKINLSLSALGNVISALVDGRSKHIPYRDSKLTRLLQDSL
GGNTRTLMVACLSPADNNYEESLSTLRYANRAKNIQNRPRINEDPKDALLREYQEEIKQL
RALISGQLGSGDLSSLLAGQLSAGPSAGPSRPQSSSTEEEKEKIKEEYEEKLARLQAEYN
AEQESKAKLQEDIAVLRSSYETKLSSLEKSRASRGHYITTAESEISILMKQALEEESCCV
TAAPHEHADLEPALAKVSQTQASRQVTSVQTGSEGEENADSPPIGTPGPLDQKHVLERLQ
QLEQEVVGGEQARNKELQQRHRQRKTLADQRKKQLIEALAENREESDNVMLNVYDSIQEE
VHAKSRLLENTQGKLKAAKLEIRDLQAEFELERNDYLATVRRLEREGHLLQALLERMAPL
VRRDCNYSNLDRLRKEATWDEDGATWRLPEVVVQKTALPSAVAPSAQRLSVRRSSVADTG
ESFQDDEDRYKEMLNRSDSENFASNYFKPKRANQLLGGEPLKGLAVHSAPQGNGTPHLTS
SGSNIGPSLSTESFLPRPFRLESLGITPSNGKVKRKKSKTHIPYEGN
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagagtcagtgaaggtagtggtcaggtgtcggccgatgaatgatagggagcaa
atactgaattgtaagatggtagtatcagtagagatgagtaggtgtcagtgtttgatcaag
aagccaggggcgaaggaggagccaccaaaacaattcacctttgatggaacctacttcatt
ggccaaaccactgagcagatgtacaacgagatcgcctaccctttggttgagggggtgact
gaagggtacaatggaacaatttttgcatatggccagactggaagtggcaagtccttcacc
atgcagggggtatctgagccagcagcccagagaggggtcatcccaagggcctttgagcac
atcttcgagagcattcagtgtgcagaaaatacaaagttcctggtgagggcttcctactta
gagatctacaatgaagaaatccgagaccttttgggaaatgacaccaaacagaaaatggag
ctgaaggagcacccagagcatggtgtatatgtgcgagacctctccttgcacactgtgcac
agcgtgggggagtgtgagcgcattatggtgcagggctgggggaatcgatctgtgggctac
accctcatgaacaaggactcctcccgctcccactccatctttaccattcacatggagatc
tgcaatacagattcagctggcgaggaccacctgcgtgcgggaaaactgaacctggtggac
ctggcaggcagtgagaggcagtctaagactggtgccactggggagcggctccgtgaggcc
accaagatcaatctgtccctgtcggctctgggcaacgtcatctctgccctggtggatggc
cgctccaaacacatcccctaccgagactccaagctgacccggctgctgcaggactccctg
ggagggaacactcgcaccctgatggtggcctgcctctcgcctgcagacaacaactatgag
gagagcctgagcaccctgcgctacgccaacagggccaagaacatccagaacaggccccgc
atcaatgaggaccccaaggatgccctgctccgagagtatcaggaggaaatcaagcaacta
cgcgccctcatctctggccagttgggcagtggcgacctgtcatcgcttctggctggccag
ttgtctgcggggccctctgctggtccatcaaggccacagtccagcagtactgaggaggag
aaggagaagattaaagaggagtacgaggagaagctggccaggcttcaggctgagtataac
gctgagcaggagtccaaggccaagctacaggaggacatagctgttctgcgctcttcatat
gagaccaagctgtccagtctggagaagtctagggccagcagagggcactatattaccacg
gctgagtcagagatctccattcttatgaaacaagctcttgaggaggagtcatgctgtgtc
actgctgccccacatgagcatgctgatttggaaccagccctggccaaggtgagccagaca
caggcatctcgccaggtgaccagtgtccagacagggtctgagggggaggagaatgcagac
tcccctcccattggcaccccaggccctctggaccagaagcatgtcctcgagaggctgcag
cagttggaacaggaagtggtgggaggggagcaggctcggaacaaggagttacagcagaga
caccgacagaggaagaccctggcagaccagaggaagaagcagctgattgaggccctggca
gagaaccgtgaggagagtgacaatgtgatgctcaatgtctacgactccatccaggaggag
gtccatgctaagagtcgactcctagagaacacccagggcaagctgaaggcggccaagctg
gagatccgggacctgcaggcggagtttgagctagagagaaacgactacctggccaccgtc
cgcaggctggagagggagggccatttgctgcaggcactgctggagcgcatggcccctctg
gtccgccgtgactgcaactacagcaacctggaccgcctgcggaaggaggccacctgggat
gaagacggcgccacctggaggctgcctgaggtggtggtgcagaaaacggccctgccatcc
gcagtagctccttcagctcagaggctctctgtacgcaggagctcagtggctgacacagga
gagtcctttcaggatgacgaggaccgatataaggagatgttgaaccgcagcgacagcgag
aacttcgccagcaactacttcaagcctaagagagccaaccagctgctgggcggtgagccc
ctgaagggactggcagttcactcagcaccccaggggaacgggacgcctcacctgacctcc
agcggctccaacatcggcccctcacttagcactgaatccttcctccctcgccccttccgc
ctcgagtcactggggatcaccccatccaatggcaaggtgaagaggaagaaaagcaaaacg
cacatcccctatgaggggaactga

DBGET integrated database retrieval system