KEGG   Salmo salar (Atlantic salmon): 106583383Help
Entry
106583383         CDS       T04363                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1D-like
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    106583383
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106583383
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     106583383
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   106583383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal RIO1 Kdo Pox_ser-thr_kin APH YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 106583383
NCBI-ProteinID: XP_014022984
UniProt: A0A1S3P612
Position
ssa22
AA seq 432 aa AA seqDB search
MGRKEITCSWKKVTNNIRDVFEFKQALGSGSFSEVFLVREKKTGNLYALKCLKKKHLSCS
NLENEITVLKKIRHDNVIGLEDFYETQTHYYLVMQLVSGGELFDRIIDRGVYTEKDASQL
VRQVLQAVNYLHENSIVHRDLKPENLLYFDSHENSKIMISDFGLSKMSDHGVMSTACGTP
GYVAPEVLAQKPYSKAVDCWSIGVITYILLCGYPPFFEDNETRLFAKIMRADYAFHSPFW
DDISESAKDFIRNMMQKHPNKRFTTEQALRHPWIIGKTARDQDIYESVSMQIQRNFAKSK
WRQAFNATAAIKHMKKLQLAHADPDAPLPPIPAIAINPCNSQNPLRGVNNITTEDVDATG
NLPIPVCHMTPPEAQYRGLRASHSEPMHAPVVMETYNAENCSSFTAAKSCDAMDRATNRN
GQMMQTGVCSVM
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgcaaagaaataacctgcagttggaagaaagtcaccaacaacatcagagatgtg
ttcgaattcaaacaagcgctgggatcgggttcgttctccgaggtgtttttggtgcgagag
aagaagacaggaaacctgtacgccctgaagtgtctgaagaaaaaacacctcagctgtagc
aacctggagaacgagatcactgtgctgaagaagataaggcatgacaatgtgattggactg
gaagatttctatgagactcagacacactattacctcgtcatgcagctggtgtctggtgga
gagctctttgaccgtatcatagatcggggggtgtacacagagaaggacgccagccagctg
gtccgccaagtactgcaagctgtcaactaccttcacgagaacagcatagtgcacagggac
ctcaagccagagaacctgctatacttcgactcacacgagaactccaagatcatgatcagt
gacttcggcctgtccaagatgtctgaccacggagtgatgtccacagcctgtggcacgcca
ggatatgttgcccctgaagttctggctcagaaaccctacagcaaggcagtggactgctgg
tccataggagtcatcacatacatcctgctgtgtggctaccctccgttcttcgaggacaat
gagacacgtctgttcgctaagatcatgagggccgactacgctttccactcgcccttttgg
gatgacatctctgagtcagcgaaagacttcatccggaacatgatgcagaagcaccctaac
aaacggttcaccacagaacaagccctcagacacccctggatcattggaaagactgcgagg
gatcaggacatctatgaatcagtcagcatgcagatccagaggaactttgccaagtccaaa
tggaggcaagccttcaacgccacagcagccatcaaacatatgaagaagctgcagttggcc
cacgccgaccccgacgcccctctccctcccatccccgccatagccattaacccctgcaac
tcccagaatcccctgcggggtgtcaacaacatcaccacagaggacgttgacgccaccggc
aacctcccgatcccagtgtgtcacatgacccctccagaggcacagtaccggggcctgaga
gccagtcacagcgagcccatgcatgcaccggtcgtcatggagacatataatgcagagaat
tgttcctcattcacggcagctaagagctgtgacgccatggacagggcgaccaataggaat
ggccagatgatgcagactggggtgtgttctgtcatgtga

DBGET integrated database retrieval system