KEGG   Salmo salar (Atlantic salmon): 106583706
Entry
106583706         CDS       T04363                                 

Definition
(RefSeq) retinol dehydrogenase 7-like
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    106583706
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     106583706
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Other DBs
NCBI-GeneID: 106583706
NCBI-ProteinID: XP_014023695
UniProt: A0A1S3P7X0
Position
ssa22
AA seq 345 aa
MDIDSVYQYLGFQAQTNDSGTSSRDNLWLYGVGTFVVLWTLGWLYRDSLEVENIKEKYVF
VTGCDSGFGNLLCKRLDRRGFRVIAGCLTEKGADDLKRATGPYLKTVLLDVTSTASIQKA
MEYTKQEVGDNGLWGIVNNAGRSLPMGPSEWMRLEDYTSTLKVNMMGVIEMTLTFLPLIK
QAQGRIVNVASVLGRVAANGGGYCISKFAVESFSDCLRRDIHYFGIKVCIIEPGFFKTAV
TSLDPIERELHRLWNQLTPEVKASYGDKYLDKYIQIQRLIMNASCDSDLSKVTNCMEHAL
VSSYPRTRYSAGWDAKFGWIPLSYMPSCVIDIGLKLVMPRPAKSV
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggatattgattctgtgtaccagtatttaggatttcaagcacaaaccaacgattcaggg
acttcaagcagggataatctatggctgtacggcgtgggtacattcgtggttctgtggacg
ctaggctggctgtacagagacagtctggaagtagagaacatcaaggagaagtatgtgttt
gtgacggggtgtgactctggctttgggaacttgctctgtaagaggctggaccggcggggg
ttcagggtgatagctgggtgtctgacagagaaaggggctgatgatctgaagagggcgact
gggccgtacctgaagacggttctcctagacgtgacgagcaccgccagtatacagaaagct
atggagtacaccaagcaggaggttggagataacggactgtggggtatcgtgaacaacgcg
ggacgctccctgcccatgggtccctcagagtggatgaggttggaggactataccagtact
ctgaaggtcaacatgatgggggtgatagagatgaccctcaccttcctgcccctcatcaaa
caggcccaggggaggattgtcaacgtggcctcggtgctgggtagggtggcggctaacggt
gggggatactgcatctccaagttcgctgtggagtccttctcagactgcctcaggagggat
atccactactttgggatcaaggtgtgcatcattgaaccaggtttctttaagacagcggtt
accagtctggatcccattgagagagagctgcatcgcctgtggaaccagctcacacctgaa
gtaaaggccagctatggagacaagtacctggataagtacatccagatccaacggttgatc
atgaatgcatcttgtgactctgacctgagtaaagtgactaactgcatggaacatgccttg
gtgtcttcctacccccgtacccgctacagtgccggctgggacgccaagtttggatggatc
cccctctcttacatgccatcctgtgtcatcgatattgggctgaaactggtgatgccacgt
cctgctaagagtgtgtag

DBGET integrated database retrieval system