KEGG   Salmo salar (Atlantic salmon): 106583972Help
Entry
106583972         CDS       T04363                                 

Definition
(RefSeq) cytosolic phospholipase A2-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00564  Glycerophospholipid metabolism
sasa00565  Ether lipid metabolism
sasa00590  Arachidonic acid metabolism
sasa00591  Linoleic acid metabolism
sasa00592  alpha-Linolenic acid metabolism
sasa01100  Metabolic pathways
sasa04010  MAPK signaling pathway
sasa04217  Necroptosis
sasa04270  Vascular smooth muscle contraction
sasa04370  VEGF signaling pathway
sasa04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    106583972
   00565 Ether lipid metabolism
    106583972
   00590 Arachidonic acid metabolism
    106583972
   00591 Linoleic acid metabolism
    106583972
   00592 alpha-Linolenic acid metabolism
    106583972
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106583972
   04370 VEGF signaling pathway
    106583972
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106583972
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    106583972
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106583972
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     106583972
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 106583972
NCBI-ProteinID: XP_014024172
UniProt: A0A1S3P9G2
Position
ssa23
AA seq 746 aa AA seqDB search
MSSIDPYQYIIVEQQFSHKFRVTVLRAKNVTKGALGDLLDTPDPYVELFIPTTPESRKRT
RHIDNDIHPEWNETFDFILDPNQDNVLEITLMDANYVMDEKLGTASYNISKMLKTGHTET
VPFLIGKATNVYLEMVLEVCTNLDLRFSLTLCDKEKLFRQARRERVMLGIKKLLDMEKPR
FLPSTPKEVPVIAIVGSGGGFRAMVGFSGVMKGLYESGVLDCATYIAGLSGSTWYMSTLF
SHPEFPSKGPKEINAELMKRVSSNPLRLLLPKHITNYIQSLWSKKANGQPVTFTDIFGML
IGETLIPARMDTKLSELQEKVNEGQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAK
YGTFMTPDLFGSKFFMGITVKQYEENPLHFLMGVWGSAFSILFNRVLGVKDTVGGSTMEE
ELEQLKPQHIVGEDSLDNDERPWKGGKENPEAEDEYGTAQNSWVQRMITSLFSGDSLFNT
REGRAGKVHNFMLGLNLNTNMPFSTFGDFMYQNSCASFEDEVDAVTDPDEFAGIYEPLDV
KSKKIHIVDSGLTYNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWARMN
KLPFPKIDPKVFDREGLKECYIFKPIKGERNCPTVIHFVLVNINFRMFKAPGVPRETEQE
KKMADFDIFDDPETPYSTFNFQYSNQAFTQLHDLMEFNTLNNIEVIKEAIKESIMYRKEN
PSRCSVSLSLNEIQNKMFLKREKAQK
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccattgacccctaccagtacattattgtggagcagcagttctctcacaaattc
agagtgacggtgttgcgagctaagaatgtcactaagggagcactgggtgacctgttggac
actcctgacccctatgtggagctgttcattcccaccacccctgagagcaggaaacgaacg
aggcacatagacaacgacatccacccagaatggaatgagacctttgacttcatactggac
ccaaaccaggataatgttctagagataacattaatggacgccaattacgtgatggacgaa
aagcttgggactgcatcgtacaacatctccaagatgttgaaaactggccacacagagaca
gtgcctttcctcatcggcaaagcaaccaatgtgtacttagagatggtcctggaggtctgt
acgaacctggacctgcggttcagcctgaccctgtgtgacaaggagaaactattcagacag
gcccgcagagagagggtgatgctgggcatcaagaagctgctggacatggaaaagccccgc
ttcctccccagcacccctaaggaggtgccggtgatcgccatagtgggttcagggggaggc
ttcagggccatggtgggcttctctggggttatgaagggcctgtatgagtctggggtcctg
gactgtgccacctacattgctggcctctctggatccacctggtacatgtcgaccctgttc
tctcacccagagttcccctctaagggtcctaaggagatcaacgcggagctgatgaagaga
gtgagcagtaaccctctgagactgctgctgcccaagcacatcaccaactacatccagtct
ctgtggagcaagaaggccaacggacagcccgtcaccttcactgacatcttcggcatgctc
atcggagagacactcatccctgcgaggatggacacaaagctgagtgagttgcaggagaag
gtgaacgagggccagtgtcctctccctctgttcacctgtctgcacgtcaaaccagacgtg
tccgagctcatgttcgcagactgggtggagttcagcccatatgagattggaatggcaaag
tacggaacgttcatgacccctgatctttttggaagcaagttcttcatgggaatcactgtg
aagcagtatgaagagaacccactacatttccttatgggggtttgggggagtgccttctcc
atcctcttcaacagagtgctgggtgtcaaagacactgtcggggggagcaccatggaggaa
gagctcgaacagttaaagcctcaacacattgtgggggaggacagtctagataatgacgag
aggccttggaaaggaggcaaggagaacccagaggcggaagatgagtacggcaccgcccag
aacagctgggtccagcgaatgatcacctccctcttcagcggcgactccttgttcaacacg
agagaggggcgggcagggaaggtccataacttcatgctaggcctcaacctcaacaccaac
atgcccttctctaccttcggagactttatgtaccagaactcctgcgcctccttcgaggat
gaggttgatgctgtcacagacccagatgagtttgctggtatctacgagccactggacgtg
aagagtaagaagatccacatagtggacagtggtctgacctataacctcccataccccctc
atcctgcgcccgcagcgtggcgtcgacctcatcatctccttcgacttctcagcccgcccc
agtgactccagcccacccttcaaggagctgctgctggctgagaagtgggcccggatgaac
aagctgccattccctaagatcgaccccaaagtgtttgaccgcgagggcctgaaagagtgc
tacatcttcaagccaataaagggggaacggaactgccccactgtcatccattttgtcctg
gtcaacatcaacttcaggatgttcaaagcccctggagtgcctcgtgagacagaacaggag
aagaagatggctgactttgacatctttgatgaccccgagacgccgtactccacgtttaac
ttccagtactcaaaccaggccttcacacaactccacgacctcatggagttcaatacactc
aacaacatcgaggtgataaaagaggcaattaaggagagcattatgtacaggaaggagaat
ccctcacgctgttctgtgtccctctcactcaacgagatccagaacaaaatgttcctgaag
cgggagaaagcccagaagtga

DBGET integrated database retrieval system