KEGG   Salmo salar (Atlantic salmon): 106585659Help
Entry
106585659         CDS       T04363                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit-like
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04260  Cardiac muscle contraction
sasa04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106585659
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    106585659
   04261 Adrenergic signaling in cardiomyocytes
    106585659
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sasa04040]
    106585659
Ion channels [BR:sasa04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   106585659
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF4064 Claudin_3 RGS12_us1 DUF4131 DUF4199
Motif
Other DBs
NCBI-GeneID: 106585659
NCBI-ProteinID: XP_014027577
UniProt: A0A1S3PIV5
Position
ssa02
AA seq 303 aa AA seqDB search
MDVSIFFKASLSAGGASCSCGCGMTLCGRKVLTVLSSVFAVCALGLLGVAVSTDYWLYLE
EGVILPLNQSTELRMSLHSGLWRVCFTAGDEKGRCFTIQYVMPTNVQLTSESTVSVLKMI
RSATPFPLVSLFFLFIGFVLSNIGHIRPHRTILAFISGIFFILSGLSLVVGLVLYISSIN
DEMLNRTKTNEAYFSYQYGWSFAFAAISFLLTETAGVMSVYLFMKRYTAEEMYRPHPGLY
GPRHSNCSDYSGQFLHPDTWNQRGRSPSSISSEASLQMNHSLHSNYPALLKCPEYDRMSS
SPC
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgtccatcttcttcaaagcttctctttctgccggtggcgcctcctgcagttgt
ggatgtggtatgaccctgtgtggcaggaaggtgttgacggtgctgagcagcgtgttcgct
gtgtgcgccctgggcctgctgggcgtcgctgtcagtactgactactggctctatctagag
gagggtgtcatcctgcccctcaaccagagtaccgagttacgcatgtccctgcactcgggc
ctctggagggtctgcttcacagctggagatgagaagggccgttgtttcaccattcagtat
gtgatgcccaccaacgtgcagctgacgtctgagtctacggttagtgtgctgaagatgatc
cgttcagccactcccttccccctggttagcctcttcttcttgttcatcggttttgtcctg
agtaacatcggacacatccggccccaccgcaccatcctggccttcatctccggaatcttc
ttcatcctctcaggtctgtctctggtggtgggcctggtgttgtacatctccagtattaat
gatgagatgttgaacaggaccaagaccaacgaggcctacttcagctaccagtacggctgg
tccttcgccttcgctgccatctccttcctgctcactgagacggccggcgtcatgtccgtc
tacctgttcatgaagcgctacacggccgaggagatgtacagaccccacccgggtttatac
gggccgcgccacagcaactgctccgactactctggtcagttcctgcacccggacacctgg
aaccagcgcggccgcagcccctccagcatctccagcgaagcctcgctccagatgaaccac
tccctccactccaactacccagcgctcctcaagtgtcccgagtacgaccgcatgtcctcc
tccccatgctga

DBGET integrated database retrieval system