KEGG   Salmo salar (Atlantic salmon): 106586477Help
Entry
106586477         CDS       T04363                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4-like
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106586477
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106586477
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106586477
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE20 family
   106586477
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 106586477
NCBI-ProteinID: XP_014029302
UniProt: A0A1S3PNP4
Position
ssa25
AA seq 1348 aa AA seqDB search
MANESPAKSLVDIDLASLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNTLKEDWIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSTGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFCSFIEGSLVKNYTQRPPTEQLLKHPFIRDQPNERQVRI
QLKDHIDRTKKKRGEKDDTEYEYSGSEEEEEEAQEQEGEPSSIVNQPGESTLRRDFIRLQ
QENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREMR
RQQEREQRRREQDDKRRMEEVERRRKEEEERRRAEEEKRRADREQEYIRRQLEEEQRHLE
ILQQQLLHEQAMLLVRPNSADERYRKNIQGSPQAAQVKVQPPVPPRAAETVANGNAPVAA
PPAMHRPMEAQVQWSHLAALKSSIATPPLVSRSHSFSEPIVPGFAHLNLRSQEQHHQPAP
SPSSSSPARTDLQPHPQPRATPLEKAPTDDSPPRVPVRTTSRSPVLSRRDSPFHGNATPS
NPVSQRKASSAAAEPRLLWERVEKLVPRPGSGSTGSSSGSSNSSSHSGSGERFRARSSSK
SEGSPLQRPEHAGKTPEERKELVRPNQPVGEVDLTALAKELRAVEDVPRPHKVTDYSSSS
EESGTTDEDDDEEVDQEGGEESTSGPEDSRAVSSRLSNGETESVKTMIVHEEGESDAKTT
PCKDGTLIVRPSAGDSKKRPVSSPGQGPVLGFVPSPGLIHPALQGHPGLQGHQERNGFAG
RIHLLPDLIQQSHHSPSSSASSSPSSSSLTSPTMSMSPQSPLDKLSMILESHSSSNSMQK
HKSSSSFTPFIDPRLLQVSPSGAALNNLAFGNDARLAEALRADPSRKGSVVNVNPVNTRP
QSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLISRRRFQQMD
VLEGLNVLVTISGKKNKLRVYYLSWLRNKILHNDPEVEKKQGWVTVGDLEGAVHYKVVKY
ERIKFLVLALKNSVEVYAWAPKPYHKFMAFKSFGDLVHKPLLVDLTVEEGQRLKVIYGSS
NGFHAVDVDSGAVYDIYLPTHIQTSIQSHAIIILPNTDGIELLVCYEDEGVYVNTYGRIT
KDVVLQWGEMPTSVAYIRSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERND
KVFFASVRSGGASQVYFMTLGRTSLLSW
NT seq 4047 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgagtctccagctaaaagtctagttgatatagaccttgcctctttgcgggac
ccagctggtattttcgaactggtggaagtggtcggcaatggcacgtatggacaagtatac
aagggccgacatgtcaagacaggacaactggcggccatcaaggtcatggatgtcacagag
gatgaagaggaggagattaaactggagattaatatgctgaagaagtactcccaccacaga
aacatagccacctattacggagccttcatcaagaagagcccaccaggacatgacgaccag
ctatggctggtgatggagttctgtggtgcaggctccatcacagacctggtgaagaacacc
aagggcaacacactgaaggaggactggatcgcctacatctcccgtgagatcctcaggggg
ttggctcacctgcacgcccaccatgtgatccaccgtgacatcaagggccagaacgtgctg
ctgactgagaacgctgaggtcaaactggtggactttggtgtgagcgcccagctggaccgg
acagtgggccggaggaacaccttcatcgggacaccctattggatggcgcccgaggtcatt
gcctgcgacgagaacccagacgccacctacgactacagaagtgacttgtggtccactgga
atcacagctatagagatggctgagggagctcctccgctgtgcgatatgcatccaatgaga
gcgctcttcctcatccccagaaaccctcctcctcgactcaagtcaaagaaatggtctaag
aagttttgcagcttcattgaaggctccctggtgaagaactacacccagcggccccccacc
gagcagctgctgaaacaccccttcatcagggaccagcccaacgagaggcaggtccgcatc
cagctcaaagaccacatcgaccgcaccaagaagaagaggggggagaaagatgatacagag
tatgagtacagtgggagtgaagaagaagaggaggaagctcaggagcaggagggggagccc
agctccatcgtgaaccagccaggggaatcaaccctgcgtagggacttcatccgtctgcag
caggagaacaaggagcgctcggaggccttgcgcagacagcagctcttgcaggagcagcag
ctccgggagcaggaggagtacaagcgccaactactggcagagaggcagaaacgcatcgag
cagcagaaagagcaaaggaggaggctggaggagcaacagcgtcgagagcgggagatgagg
aggcagcaggagcgtgagcagcggcgccgcgagcaggatgacaagaggcgtatggaggag
gttgaacgccggcgtaaagaggaggaggagcgcaggagggcagaggaggagaagaggagg
gctgaccgtgagcaggagtacatccgtcgccagttggaggaggagcagaggcacctggag
atcctgcagcagcagctgctccacgaacaggccatgttactggtgagaccaaactctgcc
gatgagaggtaccgtaagaacatccagggttctcctcaggctgcccaggttaaggtccag
cccccagttcctccccgcgccgccgagaccgttgctaatggaaacgcccccgtggccgcc
ccgcccgccatgcacagacccatggaagcccaggtccagtggtcccacctggccgctcta
aagagcagcatcgccactccccctctcgtctcacgctctcattccttcagtgagcccatc
gtccctggctttgcacacctcaacctgcgctctcaggagcaacaccatcaacctgcacca
tcaccatcatcatcatcacccgcacgcactgacctgcagccccacccccagcctagggcc
actcccctcgagaaggcccccacagacgactcccctcccagggttcctgtgaggacaacg
tccaggtctccagtactgtcacgcagggactcccctttccatggcaatgccacgcctagc
aacccggtgagccagaggaaagccagcagtgctgcagcggagccgcgtctgctgtgggag
cgggtggagaagctggttcccaggccaggcagtggtagtactggcagttcctctggttcc
agtaactccagctctcacagcggctcaggggaaagattcagagcccgctcctcatcaaag
tctgagggttctccccttcagcgcccagagcatgctgggaaaaccccagaggagaggaag
gaattggtcagacctaaccaaccggtgggggaagtggacctgacggcactggccaaagag
ctccgtgcagtggaggacgttccacgcccccacaaggtgacggactactcctcatccagt
gaagagtcggggaccacagatgaggatgatgacgaagaagtggaccaggagggaggggag
gagtctacctcaggaccagaggactctcgggctgtctcttcgaggctgagcaacggtgag
acggaatcggtgaagactatgatcgttcacgaggagggcgagagtgacgctaaaaccaca
ccctgtaaagatggcactctgatcgtcagaccgagtgcaggtgacagcaaaaagcgacct
gtctccagccctggtcaaggccctgtccttggctttgtccccagccccgggctgattcac
cctgccctccagggccaccccggtctccaaggccaccaggagagaaatggctttgcaggc
cgcattcacctcctgcctgacctgatccagcagagccaccactccccctcctcctctgcc
tcctcctccccctcctcctccagcctgaccagccccaccatgtcaatgtccccccagagc
cccctggacaagctcagcatgatactggagagccattcttccagcaacagcatgcagaaa
cacaagtcctcctcctccttcactccctttattgatccacgcctcctccaagtctctcca
tccggcgccgctctcaataacctggcatttgggaacgacgccaggctggcggaggcactg
agggcggacccgtcacgtaaaggctccgtggtcaatgtaaaccctgtcaacacacgacca
caaagcgacaccccagagatccgcaagtataagaagaggtttaactctgagatcctgtgt
gctgcactctggggagtgaacctcctggtggggacagagagtggtctgatgctgctggac
cgtagcggtcaggggaaggtctaccccctaatcagccgacgccgcttccaacagatggac
gtcctagagggactcaacgtcctggtcactatatcaggcaagaaaaacaagctgcgtgtt
tactatctgtcctggctgaggaacaagatcctgcacaacgaccctgaggtggagaagaaa
cagggctgggtcactgtgggagacctggagggcgctgtgcactacaaagttgtgaaatac
gagaggatcaagtttttggttctggccctgaagaactcggtggaggtctatgcatgggca
ccgaagccctaccacaagttcatggctttcaagtcgtttggtgacctggtgcacaagccc
ctgctggttgacctgacggtggaggaaggtcagagattaaaggtcatctatggctccagt
aacggatttcatgccgtcgacgtggactcgggggcagtctacgacatctacctgcccacc
catatccagaccagtatccagtcccatgccatcatcatcctgcccaacacagatggaatt
gagctgctagtgtgttacgaggacgagggtgtctatgtcaacacctatggacgcatcacc
aaggacgtggtgctgcagtggggcgagatgcccacttctgtggcctacatccgttctaac
cagatcatgggctggggggagaaggccatagagatcaggtctgtggagaccggacacctg
gacggggtcttcatgcacaagagagcccagagactcaagttcctgtgtgagaggaatgac
aaggtgttctttgcctcggtgcggtccggaggagccagccaggtgtactttatgaccctg
gggcgtacctctctgctcagctggtag

DBGET integrated database retrieval system