KEGG   Salmo salar (Atlantic salmon): 106588251Help
Entry
106588251         CDS       T04363                                 

Definition
(RefSeq) sphingosine kinase 1-like
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00600  Sphingolipid metabolism
sasa01100  Metabolic pathways
sasa04020  Calcium signaling pathway
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
Module
sasa_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    106588251
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    106588251
   04371 Apelin signaling pathway
    106588251
   04020 Calcium signaling pathway
    106588251
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     106588251
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 106588251
NCBI-ProteinID: XP_014032567
UniProt: A0A1S3PXZ0
Position
ssa02
AA seq 569 aa AA seqDB search
MDPKITESDPPSYRNGITKVLQYGEFTGTGNRKVRYAVSLTERDLTIQKITSTPAGRSKV
VFNLRDCVGCRAFSAVDNADAGAYFSVYFYPFKRRWMSSGVARQRVEQCFRVALFQDPRA
NLEEAEKWAGTIRESSVRQQHLRNRVLYSEVHRPCGVMLLVNPHSGKGQALSLFTGHVQR
MLNEAGIPHTLVITERQNHARELVREADLSKWGALVIMSGDGLLFEVVNGLMEREDWEKA
IQTPLGILPGGSGNALAASIHHYSGAQPVSSEELLVSCGFLLCKGLVSRMDLASVHLGSS
PSNPTRLFSFLSLAWGFVADVDVESEKYRHVGAARFTMGTLVRLASLRVYKGRLAYLPVD
EVDGEEDGQSPVSLEEMTSMSPQHQPPSSAFCSSTLLCRPLKDSPCQNAAHHTFRNSNNA
FKAKKREPMSANATLTGPPDSLLVPLDQPVPSDWVVVPEEDYVLMLAMYQSHLAKDLYVA
PDSTLDDGLIHLIYVRAGISRMALLRLFLAMEKGTHLANNCPHLVYTRVRALRLEPYSSK
GVITVDGEVVEYGPVQAQVHGGIARLITR
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atggacccgaagataaccgaatcggaccctccatcatatcgcaacggaatcaccaaggtt
ctgcagtacggggaattcacgggcacgggcaaccgaaaggtgaggtacgcggtgagttta
accgagagggacctcaccattcagaagatcacgtcgacacctgcgggacggagcaaggtg
gttttcaacttgagggactgtgtcggctgccgggctttcagcgcagttgacaacgcggac
gcgggagcgtacttctctgtctatttctacccttttaaaagacgatggatgagctctggg
gtggccaggcaacgggtcgagcagtgctttcgggtggccctgttccaagacccacgcgcc
aacctggaggaggcagagaaatgggctggcactatccgggagagctctgttcgtcagcaa
catttgagaaatcgtgtgctttacagtgaggtgcaccgtccctgcggcgtcatgctactg
gtgaacccccacagtgggaagggccaggccctcagcctcttcaccggacacgtccaacgc
atgcttaacgaggccgggatcccacacacactggtcatcactgagcggcagaaccatgcc
agggagttggtgagagaggctgacctgtcaaagtggggcgctctagtcatcatgtccggg
gatggactgctgtttgaggttgtgaatggcctgatggagagagaggactgggagaaggcc
atccagaccccactgggcatcctaccagggggctccggtaacgccctggctgcctctata
caccactactctggggcccagccggtgtcaagcgaggagctgctggtcagttgtggcttc
ctgctgtgtaagggcctggtgtctcgcatggacctggcctccgttcacctgggttccagc
ccctccaaccccacgcgcctcttctccttcctctcgctggcctggggctttgtggctgac
gtggacgtggagagcgagaagtaccgccacgtgggtgccgcccgcttcaccatgggcaca
ttggtcaggttggcatcgttgagggtgtataagggccgtctggcatacctgccggttgac
gaggtggatggagaggaggatgggcaatcgccagtctcgttggaggagatgacaagcatg
tcacctcaacaccaaccgccatcgtctgcattctgctcctccaccctcctctgccgacct
ttgaaggactcaccgtgccagaacgcagcccaccacaccttccgtaactcaaacaatgcc
ttcaaggcgaagaagagggaacccatgtccgcaaatgccaccctaacaggcccgccagac
tctctcctggtgcccctggaccagccggtgcccagcgactgggtggtggtgcccgaggag
gactatgtcctcatgctggccatgtaccagtctcacctggcaaaggacctatatgtcgca
cctgactctacacttgatgacggcctcatccacctaatatacgtccgagcaggcatatcg
cgcatggccctgctccggctcttcctggccatggagaagggcacccacctggccaacaac
tgcccccacctggtgtacacccgggtgcgggcgctgcggctggagccctactcgtcaaaa
ggggtgatcacggtggatggggaggtggtggagtatgggccggtccaggcccaggtacac
ggcgggatagccaggctcatcactagatga

DBGET integrated database retrieval system