KEGG   Salmo salar (Atlantic salmon): 106589300Help
Entry
106589300         CDS       T04363                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    106589300
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sasa03041]
    106589300
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     106589300
Spliceosome [BR:sasa03041]
 Complex C
  Other components
   Step II factors
    106589300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 S1 Helicase_C DEAD AAA_22 T2SSE AAA_19 PhoH AAA_16 AAA_30 ABC_tran Flavi_DEAD Sigma54_activ_2 Presenilin
Motif
Other DBs
NCBI-GeneID: 106589300
NCBI-ProteinID: XP_014034565
UniProt: A0A1S3Q3N4
Position
ssa28
AA seq 1206 aa AA seqDB search
MANIGDNELEQLEYLSLVSKVCTELDNHLGISDKDLAEFVISLAEKQPTFDGFKSLLLKN
GAEFTDSLVGNLLRLIQTMRPPSKASTNKAFEPVVKQKSEKDKLKDLFPALCRPDNPAPE
AILDEDDVKIADAAMKELEMFMPSVSRSDSKSKSRSDKKRRHSRSRSRDRDRRRRHRSRS
RSRSRSRDRDRQRDRDRERDRDRGKKRASRWSERSRTPSPHRDRDRDTREGSDRWKDKHV
DRPPPEEPTVGDIFNGKITSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVQ
KGQRVKIKVLSFTGSKTSLSMKDVDQETGEDLNPNRRRNQGPDGEEEKIMRNPDRPTNLN
LGHAPELEDDTLERKRLTKISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEED
EDLEIELVEEEPPFLRGHTKQSMDMSPVKIVKNPDGSLSQAAMMQSALAKERREVKQCQR
EAEMDSIPMGLNKHWVDPLPDVDGRQIAANMRGIGMMPTDIPEWKKHAFGGNKASYGKKT
AMSILEQRESLPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIG
CTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDP
DLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPI
FTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDVLVFLTGQEEIDTACEILY
ERMKSLGPEVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYV
VDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKTYRLYTERAYRDEMLT
TNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGSLDDEGLLT
RLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAK
FHQAEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVV
TCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHEL
VLTTKEYMREVTTIDPRWLVEFSPAFFKVSDPTRLSKQKKQQRLEPLYNRYEEPNAWRIS
RAFRRR
NT seq 3621 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacatcggagataacgagctagaacagctcgaatacctctcgttagtatccaaa
gtgtgcacagaactcgacaaccatctggggataagcgataaagatctagccgagtttgtc
atcagccttgctgaaaagcaaccaacgtttgatggctttaaatcacttctattgaaaaat
ggcgcagaattcacagattcacttgttggcaatttgctcagacttattcaaacaatgcgg
cctccgtcaaaggcatctacaaacaaagcttttgagcctgtggtcaagcagaagagtgag
aaggacaaactgaaggatttgtttcctgcattatgcaggccagacaatcctgctcctgag
gccatactagacgaagacgatgtgaagatcgcagacgccgccatgaaggagttggagatg
ttcatgcccagtgtgagtagatcagactcaaagagcaagagcaggtcggataaaaagagg
cggcacagcagaagtcggagccgagacagggacaggaggaggcgtcatcgttctcggtcc
cgctccagatctcgatctagggaccgtgatcgtcagagagacagagaccgtgagagggac
cgcgaccgtggtaagaaacgtgcgtctcgctggagtgagcgcagtcgcacccctagcccc
cacagagaccgagacagggacacaagggaaggttctgaccggtggaaggacaaacacgtg
gaccgccctccaccagaggagcctaccgtgggagacatattcaacggcaaaatcaccagc
atcatgcagtttggctgcttcgtgcaactggagggactgaggaaacgctgggaggggttg
gtgcacatctctgagctacgcagagagggacgtgttgccaatgtggctgatgtggtccag
aaaggtcaacgagtcaagatcaaggtgctgtcctttactggctccaagaccagtctcagc
atgaaggatgtagaccaggaaacgggggaggacctgaaccccaacaggaggaggaaccag
ggccctgatggtgaggaggagaaaatcatgaggaaccccgaccgcccaaccaacctcaac
ctgggtcacgcccctgagttggaggatgacacactggaacgcaagagactgaccaagata
tcagaccccgagaagtgggagatcaaacagatgattgctgctaatgttctttctaaagag
gagttccctgactttgacgaggagacgggtatcctccccaaagttgatgatgaagaagat
gaggacctggaaattgagctggtggaggaggagcctccgttcctgagaggacacactaaa
cagagtatggacatgagccctgtcaagattgttaagaatccagatggctcgctgtcccag
gctgccatgatgcagagtgctttggctaaggagaggagggaagtgaagcagtgtcagcga
gaggctgagatggactctattcccatgggcctgaacaaacactgggtagaccccctgcct
gatgttgatggaaggcagattgcagccaacatgagaggaattggcatgatgccaactgac
atcccggagtggaagaaacatgcctttgggggcaacaaggcctcttatggcaagaagaca
gcaatgtccatcctggagcagagagagagcctgcccatctacaagctcaaagaacagctc
atacaggctgtccatgataaccagatcctgattgttattggcgagactggttctgggaaa
actacccagatcacccagtacctggccgaggcgggctacaccactcgggggaagatcggc
tgcactcaaccccgtcgtgtggcagccatgtccgtggccaagagagtctctgaagagtat
ggttgctgtctgggccaggaggtgggctacaccattcgttttgaggactgcaccagccct
gagacggtgatcaagtacatgacagacggtatgttgctgagagagtgtttgatagatccg
gaccttggccagtacgccatcatcatgttggatgaggcccacgagaggaccatccatact
gatgtgctcttcggtctgctcaagaagacggtgcagaaacgcacagacatgaagctgatt
gtcacttcagccacgctagatgccgtcaagttctcccagtacttctacgaagcgcccatc
tttaccatcccaggacgtacctatccagtggaggtgctctacaccaaagagcctgagacg
gactacctggacgccagtctcatcaccgtcatgcagatccacctgaccgagcctccaggt
gatgtcctggtgtttctgactggtcaggaggagattgacacagcttgtgagatcttgtat
gaacggatgaagtctctgggacctgaagtgcctgaactcatcattctaccggtctactcc
gcgctgccaagcgagatgcagacccgtatctttgaccctgctccccccggcagcagaaag
gttgtcattgccactaacattgctgagacgtctctgaccattgacggtatctactacgtt
gtggacccaggatttgtgaagcaaaaggtgtacaactccaagactggtattgaccagctg
gtggtgactcccatttcacaggcccaagccaagcagcgggctggaagagctggaagaact
ggcccagggaagacctacaggctgtacacagagagagcataccgagacgagatgctcacc
accaacgtgcctgagatccagagaactaacttggccagcactgtgctgtccctcaaggcc
atgggcatcaatgacctgctatcatttgatttcatggacgctccacccatggagacgctg
atcacagccatggagcagctctacactctggggtctctggacgatgaagggttgctcact
cgtctaggacgcaggatggctgagttccctctggagcccatgctgtgtaagatgctgatc
atgtccgtccacctgggctgcagtgaggagatgctcaccatcgtctccatgctgtctgtg
cagaacgtcttctacaggcccaaggacaagcaggcgctggctgaccagaagaaggccaag
ttccaccaggccgagggagaccaccttactctgttggctgtctataactcctggaagaac
aacaagttctccaacccctggtgctacgagaacttcatccaggcccgttccttgcgcaga
gcccaggatatccgcaaacagatgctgggtatcatggacagacataaactggatgtggtg
acttgtggaaaggccacagtgcgtgtgcagaaggccatctgcagtggtttcttccggaac
gcagccaaaaaggatccccaggagggctaccgtaccctcattgaccagcaggtggtgtac
atccacccctccagtgccctgttcaaccgccagcctgagtgggtggtgtaccatgagttg
gtgctgactactaaggagtacatgagggaggtgaccaccattgacccacgctggctggta
gagttctcgccggcctttttcaaagtgtcagaccccacacgcctcagcaaacagaagaag
cagcagcgccttgagcccctctacaaccgttacgaagagcccaacgcttggagaatctcc
cgcgcctttcggcggcgctag

DBGET integrated database retrieval system