KEGG   Salmo salar (Atlantic salmon): 106590294
Entry
106590294         CDS       T04363                                 

Definition
(RefSeq) uncharacterized LOC106590294
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106590294
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    106590294
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 106590294
NCBI-ProteinID: XP_014036618
UniProt: A0A1S3Q9G2
Position
ssa29
AA seq 678 aa
MIPPGDCMYAGRKRRKPVQKQKPATVSEKSNPSKRHRDRLNAELDRLASMLPFSPDIISK
LDKLSVLRLSVSYLRVKSFFTVTHEKPSNRKHISPSTNPLPEPRKDSLPMAMGNSITESG
LLLESLTGFALVVSNDGMVFYASSTIVDYLGFHQTDVMHQNVFDYIHVDDRQEFRRQLHW
AMNPSQHGSSQDHHSAAETGEDFVVSSLFHSQEVGGVAPEFSSFLNRCFISRVRCLLDST
SGFLTMQFQGRLKFLQGQKKKSGSGALLPPQLALFCVAVPLLLPSITEMKMKGMMMRGKQ
KSGGGIIPALDHGEREEHFRRHAGSVAMVDGGDPLLLNCTNPGGSQQRLKYKSEEGYYGQ
DEPLNYCKTSMGGVPHHKGPGPDSQWPMRPASGTVRAGQSGGYIPSNRLGKAGHYGKPYR
MSPSMCHGGGRGGEVYVPKMYGSLQTTDGSDPYCLGEAVKSENGYGECYDGRLLPEMPIK
VEQDSDSENGCDAYGRPWTCREPVDRRYGNGYGDNNSLQMKSEADYYEQYSPCQRSKAGI
SPISPPYNNGHFQNYNNVGGGRPLKSVINKDLSQLSPQRLSHSDPLCSSQSINCMDVYAS
GPVEHNKGYMQHDYKLGYEFKGHGLLHAIKREPMDSPPWSDGSSNDMSHAMGHSQRNVMP
QCVMNAGQHKAIPYVYMQ
NT seq 2037 nt   +upstreamnt  +downstreamnt
atgataccaccgggagactgcatgtatgcgggcaggaaaagaaggaagcccgttcaaaaa
cagaaaccggccacggtaagtgagaagtccaacccgtcaaagaggcaccgggaccgcctg
aacgcggagctggaccggctggccagcatgctgcccttttccccagacatcatctccaag
ctggataaactgtccgtgctgcgtctcagtgtcagctacctccgggtcaagagcttcttc
acagtgactcatgagaagccgtccaacagaaaacatatcagtccatccaccaaccccctc
cccgagcccagaaaagacagcctgcctatggctatgggcaacagcataacagagagtggg
ctccttctggagtccctgactggctttgcgctggtggtgagcaacgatggaatggtcttc
tatgcctcctccaccatcgtcgactacttgggcttccatcagacggacgtgatgcaccag
aacgtctttgattatatccatgtggatgaccggcaggagttcagaagacaactccactgg
gccatgaaccccagccagcacggctcgtcccaggaccaccattcagccgcagaaactgga
gaagactttgtggtgagcagcctgttccattctcaggaggtggggggagtcgctcccgag
ttctcctctttcctcaaccgctgtttcatctcccgtgtacgctgcctgctggacagcacc
tctggctttttgaccatgcagttccaggggcggctgaagttcctccagggacagaagaag
aagtcgggttcgggggccctgctacccccgcagctggccctgttctgtgtggctgtgcct
cttctgctgccctccatcacagagatgaagatgaagggcatgatgatgaggggcaagcag
aagagcggagggggcatcatccctgcactagatcatggtgagagagaggagcacttcagg
aggcacgctggcagtgtggcgatggtggatggcggggacccgctgctcctcaactgcacc
aaccccggggggtcccagcagcgcctcaagtacaagtcggaggagggctactacggccag
gacgagcccctcaactactgcaagacctctatgggcggtgtcccccaccacaaaggccca
ggcccggactcccagtggcccatgcgccctgcctcagggaccgtccgggctgggcagagt
ggcggctacatcccctcgaatcgacttgggaaggcgggccactatggtaagccctaccgc
atgtcccccagcatgtgtcatggaggagggcgaggtggtgaggtctacgtgcccaagatg
tacgggagcctccagaccaccgacggctcggacccctactgcttgggagaggcggtgaag
agcgagaacggctacggcgagtgctacgatggccgcctgctgcctgagatgcccatcaag
gtggagcaggactctgactcggagaacggctgtgacgcctacggccgtccgtggacgtgc
cgggagcccgtggaccgtcgctacggcaacggctacggcgacaacaacagccttcagatg
aagtcggaggcggactactacgagcagtactcgccgtgccagcggagcaaggcgggtatc
agccccatcagcccaccctacaacaacggccacttccagaactataataacgtggggggc
ggcaggcccttgaagagtgtgattaacaaggacctgtcccagttaagtccccagagactg
tcccactcagatcccctctgtagcagccagagcatcaactgcatggacgtttatgcaagc
ggccccgtggagcacaacaagggctacatgcagcatgactacaagctgggttacgagttc
aaaggtcacggactgctccacgccataaagcgggaacccatggactcacccccgtggtca
gacggcagcagcaacgacatgagtcatgccatggggcactctcagaggaacgttatgcca
cagtgtgtgatgaatgctgggcagcacaaagccatcccctatgtttatatgcaatag

DBGET integrated database retrieval system