KEGG   Salmo salar (Atlantic salmon): 106590836Help
Entry
106590836         CDS       T04363                                 

Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I-like
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106590836
   04020 Calcium signaling pathway
    106590836
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sasa04040]
    106590836
Ion channels [BR:sasa04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   106590836
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 106590836
NCBI-ProteinID: XP_014037494
UniProt: A0A1S3QDJ9
Position
ssa02
AA seq 422 aa AA seqDB search
MATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGELVCNADYPCEGMSRHAT
FENFGMAFLTLFQVSTGDNWNGIMKDTLRECPPGPSDYPCHAGLQFISPMYFVSFVLTAQ
FVLINVVVAVLMKHLDDSNKEAQEDAEMDAEIELELAQGQLQLPTCCMGGLGTGLVVAGA
SGAPGCGGGGLEGGTRPGQGVGLMTGAVVDHSGVTPPHRGAERHEGHRRHHRQKLYSPAQ
VCAQESQWLDSISLLIKDSFEGEMLMIDNLSGSVFHHYSSTSPPVWNDCKSHPQLEQIRL
AEIEQASLRSDQMSDKSSSPALPDDLSLDDQSVHQLLVREGKEERGSDSQGSEEAGGGGD
SLTQGQTGGSRRCRAHSSVAEEGAPLLVEVGVHQRHKTPSHHSPGGTSCSSTKAGEGSDE
GG
NT seq 1265 nt NT seq  +upstreamnt  +downstreamnt
atggctacaggaatgagagctcttctagacacagtggttcaggctctacctcaggtgggg
aacctgggcctgctgtttatgttgctgttcttcatctacgctgctctgggggtggaactg
tttggagagctggtgtgtaatgctgactacccgtgtgagggcatgagtcggcacgccacc
ttcgagaacttcggcatggcctttctcaccctcttccaggtctccaccggagacaactgg
aacggcatcatgaaggacaccctgcgtgagtgccctccaggtccaagtgactacccgtgc
cacgctggactccagttcatctctcccatgtactttgtctccttcgtcctcaccgcccag
tttgtcctcatcaacgtggtggtggccgtgctcatgaagcacctggacgactcaaacaaa
gaggcccaggaggatgctgagatggatgcagagattgagctggagcttgcccagggacaa
ctccaactacccacctgctgcatgggggggctgggcactgggctggttgtggctggggcc
tctggagcgcctggatgtggaggtggagggttggaaggcgggaccaggccgggtcagggg
gtagggctgatgacaggagccgtagtggatcacagtggagtgacccctccccatagagga
gcagaaagacatgagggacacagacggcatcacagacagaagctgtactcacctgcacag
gtttgtgcacaggaaagtcagtggttggacagtatatctctgctgataaaggactcattt
gaaggagagatgctgatgattgacaacctctctggatctgtcttccatcactactcctct
acctctcctcctgtctggaatgactgtaagagccacccacaactagagcagatcaggctg
gcagagatagagcaggcatctctgaggtcagaccaaatgtcagacaagtcgtcgtctccg
gccctacctgatgacctcagcctggacgaccagagtgtccaccagctgctggtgcgggag
ggcaaggaggagaggggcagtgactcccagggctcagaggaggctggcggaggaggggac
tccttgacccaaggccaaacaggggggtcgaggcgctgcagggcccatagttcagtagcc
gaggagggggctccactcctggtggaggtgggggtccatcagagacacaagaccccatcc
caccacagccctggtggcacctcctgcagtagcactaaggcaggagaaggatcagatgag
ggagg

DBGET integrated database retrieval system