KEGG   Salmo salar (Atlantic salmon): 106591341Help
Entry
106591341         CDS       T04363                                 

Definition
(RefSeq) serine/threonine-protein kinase PLK1-like
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04114  Oocyte meiosis
sasa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106591341
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106591341
   04114 Oocyte meiosis
    106591341
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    106591341
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106591341
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106591341
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     106591341
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   106591341
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     106591341
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106591341
  Sister chromatid separation proteins
   Polo kinases
    106591341
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: POLO_box
Motif
Other DBs
NCBI-GeneID: 106591341
NCBI-ProteinID: XP_014038029
UniProt: A0A1S3QF26
Position
Un
AA seq 158 aa AA seqDB search
MIMYADGDSLQYIDKMAAESYLSVRSYPATLSKKITLLKYFRNYMSEHLLKAGANITPRD
GDELARLPYLGHWFRTKSAIVLHLTNGTVQINFFQDHTKLILCPLMGAVSFIDEKRDFRT
YKTSLIQEFGCCKELASRMSYARLMVAKLLSCKSSTPR
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgtacgccgacggagacagtcttcagtacatcgacaagatggccgctgagagc
tacctcagcgtccgctcctacccagctacgctctccaagaagatcacgttgttgaagtat
ttccgtaactacatgtcggagcaccttctgaaggcgggcgccaacatcacgccgcgggac
ggggacgaactcgcccgtctgccgtacctcggacactggttcagaaccaagtccgccatc
gtcctccacctcaccaacggcaccgtgcagatcaacttcttccaggaccacaccaagtta
atcctgtgtcccctgatgggcgccgtgtccttcatcgacgagaagagagacttcaggacg
tacaagacgtctctgatccaggagtttggctgctgtaaagagctggccagcaggatgagt
tacgccagactgatggtggccaagctactgtcctgcaagtcctccactcctcgctaa

DBGET integrated database retrieval system