KEGG   Salmo salar (Atlantic salmon): 106593184Help
Entry
106593184         CDS       T04363                                 

Definition
(RefSeq) bone morphogenetic protein receptor type-2-like
  KO
K04671  bone morphogenetic protein receptor type-2 [EC:2.7.11.30]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04060  Cytokine-cytokine receptor interaction
sasa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    106593184
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106593184
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106593184
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     106593184
Protein kinases [BR:sasa01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   106593184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Pkinase_fungal RIO1 Choline_kinase Haspin_kinase PI3_PI4_kinase
Motif
Other DBs
NCBI-GeneID: 106593184
NCBI-ProteinID: XP_014039995
UniProt: A0A1S3QIY4
Position
Un
AA seq 302 aa AA seqDB search
LLRLFYLLHIYTYPSCYRESDQNGIEIQSSFLNLSSPSFSLCQLIGRGRYGSVFCGLLDE
RQVAVKVFSSANRQNFLNECSIYCLPLLEHDNIAHFIAADERLGAEGRLEYLLVMEYYPH
GSLYRYLGLQTGDWMSSCRLAHSITRGLAYLHTELLKGDFYKPAVSHRDLNSRNILVKND
GTCVIIDFGLSMKLTGNRPVRQGEEENAAISEVGTVRYMAPEVLEGAVNLRDCESALKQV
DMYSLGLIYWETFMRCTDLFPGNNPDLVYWETFMRCTDLFPGNNPGNNPDLVYWETISEM
RL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
ctgctaaggctattctacctactacacatctacacctaccccagctgctacagagaatcg
gaccaaaatggaattgagatccagtcgtcttttctcaacctttcttctccctctttttct
ctctgtcagctgataggtcgaggccggtacggctcggtgttctgtggtttgttggacgag
cgacaggtggctgtgaaggtgttcagctcagccaatcggcagaacttcctgaacgagtgt
tccatttattgtctccccctgctggagcacgacaacatcgcacacttcatcgctgccgac
gaacggctgggggcagagggccgactggagtaccttctggtcatggagtactacccccac
ggctcgttgtatcgctacctggggctgcagacaggagactggatgagtagctgtcgtctg
gcccattccatcaccagaggcctagcctacctgcatactgagctgcttaaaggagacttc
tacaagccagctgtgtctcacagagatctgaacagtcggaacattctggtgaagaacgac
ggaacgtgtgtcatcatcgactttggcctctccatgaagttgacggggaaccggccggta
cggcagggagaggaggagaacgctgccatcagtgaggtgggtacagtccgctacatggcc
ccagaggttctggaaggggcggtgaacctgagggactgtgagtcggctctgaagcaggtg
gacatgtactccctcggcctcatctactgggaaaccttcatgaggtgtactgacctcttc
ccaggtaataaccctgaccttgtctactgggagaccttcatgaggtgtactgacctcttc
ccaggtaataacccaggtaataaccctgacctcgtctactgggagaccataagtgagatg
agactatag

DBGET integrated database retrieval system