KEGG   Salmo salar (Atlantic salmon): 106593469Help
Entry
106593469         CDS       T04363                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00071  Fatty acid degradation
sasa01212  Fatty acid metabolism
sasa03320  PPAR signaling pathway
sasa04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106593469
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    106593469
   03320 PPAR signaling pathway
    106593469
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sasa03029]
    106593469
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     106593469
Mitochondrial biogenesis [BR:sasa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    106593469
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPT_N Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 106593469
NCBI-ProteinID: XP_014040278
UniProt: A0A1S3QRW9
Position
Un
AA seq 237 aa AA seqDB search
MAEAHQAVAFQFTVSPDGIDLQLSHEALRQIYLSGLHSWKKKFIRFKNGVMTGVYPGSPT
GLMLVVGLYMGRAKYVQADPSLALFTKVGAHLPVSRYMSFENQQVVGGVLVGTGLWVAIF
FTMRTSLKWLLSWHGWMYARHGTVPWRTRIWLVLVKIFSGRRNPQLYSFQTSLPQLPLPS
VKDTINRYLESARPLMDDEQYLRMEGLAKDFEKGLGPKLQWYLKLKSWWATNYVSHI
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagctcaccaggctgtggcattccagttcaccgtctctccagacggcattgat
ctgcagttgagccacgaggccctgagacaaatctacctgtctggcctgcattcctggaag
aaaaagtttatccgcttcaagaatggggtgatgaccggggtgtaccctggcagtcccacc
ggcctgatgttagtggtggggctgtacatggggagggcaaagtacgtccaagctgaccct
tccttggcactgttcaccaaagtgggtgctcacctgcctgttagtcgctacatgtccttt
gagaaccagcaggtggttggcggtgtgctagttggcacagggctctgggtggccattttt
ttcaccatgcgaacttcactcaagtggctgctctcctggcatggatggatgtatgcccgt
cacggcactgtgccatggaggacacgcatctggctggtactggtgaaaatcttctccgga
aggcggaatccccagttgtacagcttccagacatcgttaccacagctccctctgccttcg
gtgaaagacaccatcaatagataccttgaatctgcccgtccgctcatggacgacgaacag
tacttgaggatggagggccttgccaaggattttgagaaaggcctgggtcctaaacttcag
tggtacctgaaactcaaatcctggtgggctacaaactatgtaagtcacatttga

DBGET integrated database retrieval system