KEGG   Salmo salar (Atlantic salmon): 106594463Help
Entry
106594463         CDS       T04363                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106594463
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sasa04030]
    106594463
G protein-coupled receptors [BR:sasa04030]
 Rhodopsin family
  Lipid
   Leukotriene
    106594463
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 106594463
NCBI-ProteinID: XP_014041308
UniProt: A0A1S3QMM3
Position
Un
AA seq 312 aa AA seqDB search
MEQHNFSTFISFTLNSSNSNASFLSPAPIPWNHEGLVPGVVLSLCFLIGIPGNIAVMVFL
CWNHDLSSLSRRLMLNLAASDLLCLITLPALIHSILFSWIVGRALCKFISILIYCGIYTS
LLTVTFLSIQRYLQVLYPQTWAMLGVATERGMLVVLWGVAGVLSIPNGVVRDLKQDENGH
FHCTFVFVSDAQQVAVLLLETVLGFVVPFSIMATAYICLHRRVSQTAFFRSPKMTRLVTS
IVVTFSVLWTPHHVMNLVGLSAIFVGDKALRGVWEAHWIIVGSLTFINSCLDPFLYAFAS
RNTHPENNTNPV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggagcaacataacttctccaccttcatctccttcaccttaaactcctccaactctaat
gcctccttcctcagtcctgcacccatcccttggaaccatgagggtctggtccctggcgtg
gtcctgtctctttgcttcctaatcggcattcccgggaacatcgcagtgatggttttcctc
tgttggaaccacgatctatccagtttgagccggagactgatgttgaacttggctgcatct
gacctgctatgccttatcaccctgcctgcattgatccacagcattctgtttagctggata
gtgggtcgggctctttgcaagttcatttccatcctgatttactgtggcatctacaccagc
ttgctgactgtcacgtttctgagcatccagcgttacctccaggttctgtatccacagact
tgggccatgctgggagtggcaacggaaaggggaatgctggtggtcctgtggggggtagcc
ggggtcctatctatccctaatggggtggtgcgagatttgaagcaggatgagaatggacat
ttccattgtacgtttgttttcgtgtcagacgctcagcaagtggccgtgttgctcctagag
actgttctgggatttgtagttcctttctccatcatggccacagcctatatctgcctccac
cgaagagtgagccaaacagcttttttcaggagccccaagatgaccagattagtgaccagc
atagtagtgacattttctgttctttggactcctcaccatgtcatgaacttggtgggattg
tcagcaatctttgtaggggataaggctctgagaggagtctgggaggcccattggataatt
gttggatctctgacctttatcaacagctgtttggatccattcctctacgcctttgcctcc
agaaacacccacccagagaacaataccaatccagtgtga

DBGET integrated database retrieval system