KEGG   Salmo salar (Atlantic salmon): 106595316Help
Entry
106595316         CDS       T04363                                 

Definition
(RefSeq) nuclear envelope pore membrane protein POM 121-like
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00340  Histidine metabolism
sasa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    106595316
Enzymes [BR:sasa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     106595316
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 106595316
NCBI-ProteinID: XP_014042168
UniProt: A0A1S3QQ34
Position
Un
AA seq 537 aa AA seqDB search
MRSFGLKNLQGHIRHGVEMAKLLESLVRCDPNFDMPAERHLGLVVFCLKEGNALTQELLR
RLTRSGTMYLVPADIDRKRIIRFTVTSQLTTSEDIIRDWNIIRKMAADLLAEDAEKQAVS
KMEEQQSPVRKTVEKLSETNSDSENHTTTAAEGLAASLMTRKPKEIEKAISHTEDETLKT
PKKQETGPTQTSPKTGSKELEAGQTQTSPKTGSKELEAGQTQTSPKTGSKELEAGQTQTS
PKTGSKELEAGQTQTSPKTGSKELEAGQTQTSPKTGSKELEAGQTQTSPKTGSKELEAGQ
TQTSPNTGSKELEASPKTGLRELVTSQAQTSQDPETGARDGPKEIPCTAAFRVQRVQPQL
RLDSDKTGFRPQPPFWMDKEKSGSENRPRRTVRSLSCSSEPLPGPIGPLFSHNTDPLSKP
LSSSVTDSQPGHKDPDLIHPLNDTQLRRLSSGPSPSGLFQIPEWPSPTNSNQLGKRVLRK
LTKFYSLPSFCHLWVQCGHYQVCCPVRGLQIAPKLRSPQIPGPPLGVGDSAVGLVPL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccttcggtctgaagaaccttcagggacacatcagacatggtgtagagatggct
aagctactggagtccctggttagatgtgaccctaactttgacatgcctgctgagagacac
cttggcttggtggtcttctgtctcaaggaagggaatgccctgactcaggagttgctacgg
cgactgacgcggtccggcaccatgtaccttgtccccgccgacatcgataggaaacgcatc
atccgcttcaccgtgacgtcacagctgaccacctcagaggacatcatcagggactggaac
atcattcgcaaaatggccgccgaccttctggccgaggatgctgaaaaacaggcagtcagt
aaaatggaggagcagcagtctccagtcagaaaaactgttgagaagctgtcagagacaaac
agtgattcggagaatcacacaacaacagcagcagagggcttggctgcctctctcatgact
aggaaaccaaaggagattgaaaaggcaatcagtcacacagaggatgaaacactgaaaaca
cccaaaaagcaagagaccggcccgacacagaccagccccaagacaggatccaaagagctg
gaggctggccagacacagaccagccccaagacaggatccaaagagctggaggccggccag
acacagaccagccccaagacaggatccaaagagctggaggctggccagacacagaccagc
cccaagacaggatccaaagagctggaggccggccagacacagaccagccccaagacagga
tccaaagagctggaggccggccagacacagaccagccccaagacaggatccaaagagctg
gaggccggccagacacagaccagccccaagacaggatccaaagagctggaggccggccag
acacagaccagccccaatacaggatccaaagagctagaggccagccccaagacaggactc
agagagctagtgaccagccaggcccagaccagccaggacccagagacaggagccagagat
ggccctaaagagatcccctgtactgctgccttcagagttcagagggtccaaccacagctc
cgcttggacagtgataagactggatttagaccacaaccaccattctggatggataaagaa
aagtctgggtctgagaacaggccgaggaggacagtacgctctctgagctgcagcagtgag
cccttacctggccccattgggcccctgtttagtcataacactgatcccctttctaagcct
ctctctagctctgtcacggactcgcagcctggacataaagacccagacctcatccacccc
ctaaatgacacccagctcaggcgtctctcctcaggcccaagcccctcaggcctctttcag
atcccagagtggccttctccaaccaattccaaccagctgggaaaacgggtcctgaggaag
ctcaccaagttctacagcttgcccagtttctgccacctgtgggtgcagtgtgggcactac
caggtgtgctgccctgtcaggggacttcagattgccccaaagctcagatctccccaaatc
cctggtcctcctctgggtgtaggagactcagctgttggtcttgttcctctgtga

DBGET integrated database retrieval system