KEGG   Salmo salar (Atlantic salmon): 106596058Help
Entry
106596058         CDS       T04363                                 

Definition
(RefSeq) glutathione peroxidase 6-like
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00480  Glutathione metabolism
sasa00590  Arachidonic acid metabolism
sasa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    106596058
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106596058
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     106596058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 106596058
NCBI-ProteinID: XP_014042853
UniProt: A0A1S3QS02
Position
Un
AA seq 134 aa AA seqDB search
MNALMEMFGDLNFTVLGFSCNQFGLQAPEVNHETLNLLKYVRPGGGFVPKFPVFGKIEVN
GLNEEPLFAYLKESLPYVNPVIGDIKKFYWSPIKVNDIRWNFEKFLINSDGAPFRRYELH
GPTENVEKDIAGLL
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcactcatggaaatgtttggtgacctcaacttcactgtcctgggattctcctgc
aatcagtttggtcttcaggcacctgaggttaatcatgaaaccctcaaccttctcaagtat
gtaaggccaggtggggggtttgtccccaagttccctgtgtttggcaagatcgaggtcaat
gggttgaatgaagaacctcttttcgcctatctcaaggagtctttgccctatgtgaaccct
gtcataggagatataaagaagttctactggtcacccatcaaagtcaatgacattcgctgg
aactttgagaagtttctaatcaattctgatggggcgcctttcaggcgttatgaacttcat
ggccctactgagaacgtggagaaagacatcgcaggcctactataa

DBGET integrated database retrieval system