KEGG   Salmo salar (Atlantic salmon): 106599299
Entry
106599299         CDS       T04363                                 

Definition
(RefSeq) uncharacterized LOC106599299
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106599299
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    106599299
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 106599299
NCBI-ProteinID: XP_014045937
UniProt: A0A1S3R252
Position
ssa03
AA seq 631 aa
MMIPPGDCLYAGRKRRKPIQKQKQTAASQKTNPSKRHRDRLNTELDRLASLLPFTPDIIS
KLDKLSVLRLSVSYLRVKSFFQAIQEKPCRKHIMKPHLNHQDTRKESLPIGTPGTSISLV
ERDLLLESLTGFALVVSTDGLIFYVSTSIVDYLGFHQTDVMHQNVFDYIHVEERQEFRRQ
LHWAMNPGPQGASLDQHSATVTDDDFVMSSLFNAMEPDGVPLELTSFLTRCFIARVRCLL
DGTLGFLSMQFQGSLKFLQGQMKKTESGALLPPQLALFCVAVPLVMPSITELKMKNMTAR
SKNKGPVITTPEKHSSTTREPCHYTPWTPLSKDGTRYKNNSYYTQEEPLNFCLSSMSGGP
KAQSMDHPWDIRTGSALRKGPSGTNTPGRQSKYNHLGKTRSYRMSPGYHANRQDASQNKL
YGGLHSPEVESYCEDHMKTDNRYMGGHLDCYNGMVLPETAIKTEQDSDSENGCNIYGMPQ
NRAWVGNEKRYMGYSEEPQVKSEADYYEQYTTCQKNKTNMSPTLNGHHKYLYTAGNRAQK
DHRIPHSDTLCSSQGENCMDISVYGYMQQDNKLNYEFRNHLVHTIKREPMDSPPWSDSGH
DISQIPMQRSMIPNSAMNAIVYKPNPYIYMQ
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgatgattccacctggggactgcttatatgcgggaaggaagagaaggaagcccatccaa
aaacaaaaacagacagcggccagccagaagaccaacccgtctaagaggcaccgtgaccgt
ctgaatacagagctggaccggctggccagtctcctacccttcaccccggacatcatctcc
aaactggacaagctctccgtgctgcgcctcagcgtcagctacctccgggtcaagagcttc
ttccaagccatccaggagaagccatgcagaaagcacatcatgaagccgcatttgaaccac
caggataccaggaaagagagcctgcccattggaaccccggggaccagcatcagcttggta
gagagggacctcttactggagtccttgactggttttgccttggtggtgagcacagatggg
ttgatattctacgtctccacctccattgttgactacctgggctttcatcagacggatgtg
atgcaccagaatgtatttgattatatacatgtggaggagcggcaggagttcagaagacag
ctccactgggccatgaaccccgggccccagggggcgtccctggaccagcactcggccaca
gtaactgatgatgactttgtgatgagcagtctctttaatgccatggagcctgacggtgtt
cctctagagctcacctctttcctgactcgctgtttcatcgcccgggtccgctgcctattg
gacggcaccttaggctttctgagcatgcagttccagggcagcctgaagttcctgcagggc
cagatgaagaagacagagtccggggcactgctgcctccccagctggccctgttctgtgtg
gccgtgcccctcgtgatgccctccatcacagagctgaagatgaagaacatgacggccagg
agcaagaacaagggccccgtcatcaccacaccggaaaagcacagcagcactaccagagaa
ccctgccactacaccccatggacacccctctccaaagacggcaccaggtacaagaacaac
agctactacacccaggaggagcccctaaacttctgcctatcctccatgagtggtgggccc
aaagctcagagcatggatcatccatgggacatccgcacagggtccgccttgcgaaagggt
cccagcggcaccaacacaccaggcagacaaagcaagtacaatcacctggggaagactaga
tcctacaggatgtctccaggatatcacgctaacagacaggatgcatctcagaacaagctg
tatggaggcctccacagccctgaggtggagagctactgcgaagatcacatgaagacagac
aaccggtacatgggcggccatcttgactgttacaatggcatggtgttgcctgagacggcc
ataaaaacagagcaggactctgactcagaaaacggttgcaatatctacggcatgccccaa
aatagagcctgggtggggaacgaaaagcgctacatgggctactcagaagaaccacaggtg
aagtcagaggctgactactatgaacaatacaccacctgccaaaagaacaagaccaacatg
agcccaacgctcaatggacaccataaatacttatatacagcagggaacagggctcagaag
gatcataggataccacactcagacactctgtgtagcagtcagggagaaaactgtatggac
atcagtgtatatggctacatgcagcaagacaacaaactgaactacgagttcaggaatcac
ctggtccacactataaagagggaacccatggactcacctccttggtctgacagtggccat
gacattagccaaatacccatgcagagaagtatgattcctaactcggcaatgaatgctatt
gtatacaaaccaaacccatatatctacatgcaatga

DBGET integrated database retrieval system