KEGG   Salmo salar (Atlantic salmon): 106601059Help
Entry
106601059         CDS       T04363                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106601059
Membrane trafficking [BR:sasa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    106601059
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N TEA
Motif
Other DBs
NCBI-GeneID: 106601059
NCBI-ProteinID: XP_014048436
UniProt: A0A1S3R8I1
Position
ssa03
AA seq 2139 aa AA seqDB search
MASSTNERRAFAHKINRTVAAEVRKQVSREYGSPQLSKKRGAHQPVPLTEVVEPVDYEEY
VSSHAPGAEPGPLRQLMEFPPDDLELLLQDRECTTLEPPLPEEDTFDPRVRDALGVYTDD
WLIIQRKYQRYSTTHTPHNSERQRERQRGLVKQTFELDEAAATDRQDDQDDAKRRSVSLD
DTPRGSWASSIFDLKNSSPDALLPSVLERTAAEDMDRRNAEARLQGRHSDLLGLFPPPDE
DEAVERCSVPEVPKEHCGQRIMVKCLSLKFEIEIEPIFGTLALYDVKEKKKISEDFHFDL
NSDQMKGLLRLHTPHTAISTLARSAIFSITYPSADIFLVIKLEKVLQQGDIGESCEPYMV
MKESDSSKVTHKEKLEKLRLQAETSCSRLGRYRMPFAWTAIHLVNIVSSVGGLERSDPDS
DSERKGHGTWNERKKKGFERMSVGEDMCNFSTFRPATLTVTNFFKQEGDRLSDEDLYKFL
ADMRRPSSVLRRLRPVTAQLKIDISPAPDSPHYCLSPELLHVKPYPDLRVRPTKEVLEFP
ARYVYTPHTTYRNLLYIYPQSLNFSSRQGSVRNIAVKVQFMAGEDLSLAMPVIFGKSSCT
EFFTEAYSPVIYHDKSPEFYEEVKMKIPANLTDNHHLLFTFYHISCQPKQNTPLETPVGY
TWIPLMQHGRLRTGSFSLPVSVEKPPPSYSVLTPDVQLPGMKWVDNHKQVFNVEVTAASS
VHTQDPHLDKFFTLCYVLEEYSFPFRLKDCIISEANVEGELKASMTGLRGALLDTCVRFL
HQLLSKLILLIVHPPVIAGQIVNLGRAAFEAMSLLVNQIHKNLEGNQDQHGRNNLLASYI
HYCFHLPTAEPAMPPTGGATPAYELPIQYATLSRATARPSTLHLARSKSISNSNPDLAST
PTSPDEEVQRIISSKGIDRSHSWVNSAYAPGGSRAVLRRNPNFTCELKQASDRGCNRMSA
FVDSATFCSAPTRQIAKKLLHEELALQWVVSTSTVREAALQQAWFFFQLMTKSMSHHLFL
SSRIDLPRRQRFPDRFVDDIAALVGAISADVAGRYHKDVELVERLNSSLAFFLNDLLSLM
DRGFVFNLIRSYYKQIANKFHTAQNPSSLTALRMDFTRILCSHEHYVTLNLPCSTLSPPA
SPSPSTSSTTSQGSAFSSMHQDQGVASMFELSVPFRQQHFLSGLLLTELSLILEPDGEGV
FFLHKKAISAVHSLMSSHDADPRYTDPQVRTHIAQLYLPLIPIVMDTLPQLHDFTDTSQA
RGRHAPAMQDDGDPDNGTISQSVAMAIAGSPLPHAKAPNFTMPTVAGRQCSSLSAECSRT
LLVSFLWVLKNADAALLESWVSDLSVMQINRLLDLLHLSVSCFEYKGKKALERINSLTFK
KSQDMKARLEEAILGTIGARQEMVRRCRERSPYGNENVRWRKNVTHWRQNTDRVNKTKAE
TEQESVVDGNLATEASLVVLDTLEIIVKTVLVSELKESVLGGVLRVLLHSMAGSQSALFL
QHCFTTQRGLVFKFPEMLFEEDTELCADLCLRLLRHCSSSVGSVRSQASASLYLLMRQNF
EIGNNFARVKMQVTMSLSSLVGTSQNFNEEHLRRSLKTILTYAEEDLELRDSPFPEQVQD
LVFNLHMILTDTVKMKEHQQDPEMLIDLMYRIAKGYQNSPDLRLTWLQNMAGKHSERGNH
AEAAHCLVHSAALVAEYLNMLEDCRYMPIGCVTFQHISSNVLEESAVSDDILSPEEEGIC
AGKYFSELGLVGLLEQAATSFHMASMYEAINEVYKILLPVHEANRDFKKLATVHGKLQDT
FNKIYNQSSGWERMFGTYFRVGFYGCRFGDLDEQEFVYKEPSITKLAEISYRLEEFYAER
FGDDVVEIIKDSNHVDKNKLDPNKAYLQITYVEPFFDTYELKERITYFDKNYNLRTFMYC
TPFTLDGRAHGDLHEQYKRKSILTTSHAFPYIKTRINVIHKEEIILVPMEVAIEDMQKKT
QELAFATHQEPADAKMLQMVLQGSVGTTVNQGPLEVAQVFLSDIPDDPKLYRHHNKLRLC
FKDFTKRCEDALRRNKTLIGPDQKEYHKEMERNYNKLKESLGPLITRKIPQLYRTLPAAG
LQSATQRLQIKEIPSVVPVSAGGTVEAQQTSSTEKKPRA
NT seq 6420 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttcaaccaacgagaggagggcatttgcacacaaaattaatcggacggtggct
gcagaggtcaggaagcaggtatccagagagtatggctcccctcagctgtccaaaaaacga
ggagcacaccaacctgtgccgctgaccgaggtggtggagcctgtggactatgaggagtat
gtgagtagccacgcccctggggcggagcctggccccctcagacagctgatggagttcccc
ccagacgacctggagctcctcctgcaggacagagagtgtactacactggagccccctctg
cccgaggaggacacatttgacccaagagtgagagatgccttgggtgtctacacagatgac
tggttgatcattcagaggaagtatcaacgttacagtacaacccacaccccccacaactct
gagcgccagagggagaggcagcgagggctggttaagcagacctttgaactggacgaggct
gcggccactgaccgccaggatgaccaggacgatgctaaacggcggtcagtctctctggat
gacacgccccggggtagctgggcctccagtatttttgacctgaagaactcgtcgccggac
gccctgctgccctcggtgttggagcgcacggctgcagaggacatggaccgccgcaacgct
gaggcccgcctgcaggggcgccactctgacctgctggggctcttccctcctcccgacgag
gatgaggctgtggagagatgttctgtcccagaggtccccaaagaacactgtggtcagagg
atcatggtcaagtgtctgtccctcaaatttgaaatagaaattgagccaatatttgggact
cttgctctctatgatgtcaaggaaaagaaaaagatctcagaggacttccactttgacctg
aactcagatcagatgaagggcttgctgcgtctccacacgccccacacagccatctccacc
ctggcccgctcagccatcttctccatcacgtacccctctgcagacatcttcctggtcatc
aagctggagaaagtccttcagcagggagacataggggaatcctgtgaaccctacatggtc
atgaaagagtcggattcatcaaaggtaacacacaaggagaagctggagaagctgcgtctg
caggcggagacgtcgtgtagcaggctggggaggtacaggatgcccttcgcctggacggcc
atccacctggtcaacatcgtcagcagtgtgggggggctggagcgctccgaccccgactct
gactctgagcggaaaggccatggaacttggaacgagagaaagaagaaagggtttgagcgg
atgagtgtaggagaggacatgtgtaacttttccaccttccgtccagccactctcacagtc
accaacttcttcaaacaggagggggacaggctgagcgatgaagacctctacaagtttctg
gcagacatgcgcagaccgtcctctgtcctacgcagactgagacctgtcacagcccagttg
aagatagacatctctcctgccccagactctcctcactactgcctgtctcctgagctgctc
catgtcaagccctaccctgacctgagggtgcgccccaccaaggaggtgctggagttccct
gcccgctacgtctacacccctcacactacctacaggaacctgctgtatatctacccccag
agcctgaacttcagcagtcggcagggctcagtcaggaacattgctgtcaaggtgcagttc
atggcaggagaggatctcagtctggccatgccggtgatctttgggaaatccagctgcact
gagttctttactgaggcttattcacccgtcatctaccatgacaagtctccagagttctat
gaggaggtgaagatgaagattccagccaacctgacagacaaccaccacctcttgttcacc
ttctaccacatcagctgtcagcccaaacagaacacgcccctggaaacgcccgtgggatac
acctggattcctctgatgcagcatggccgtctacggaccggttccttcagtctgccggtc
tctgtggagaaacccccacccagctactccgtcctcacccctgacgtgcagcttccaggc
atgaagtgggtggataatcacaagcaggtgttcaatgtggaggtgacagctgcctcctca
gttcacactcaggacccccacctggataagttcttcaccctgtgttacgtcctggaggag
tactcgttcccgtttcgtctgaaggactgtatcatcagtgaggccaacgtggagggtgag
ctgaaggccagcatgacgggcctgcggggggcgctactcgacacatgcgtccgcttcctc
caccagctgctctccaaactcatcctgctcatcgtccacccgcccgtcatcgcaggacag
atcgtgaacctgggccgtgcagcgttcgaggccatgtccctgctggtcaaccagatccat
aagaacctggaggggaaccaggaccagcatggcaggaacaacctgctggcctcctacatc
cactactgcttccacctgcccactgctgagcctgccatgccccctactgggggggccacc
ccggcctacgagctgcccatccagtacgccacgttgtccagggcaacggcccgccccagc
accctgcacctggcccgctccaagagcatcagtaactccaaccctgacctggccagcacc
cccacgtcacctgacgaggaagtgcagaggatcatctccagcaaggggatagaccgctcc
cactcctgggtaaactctgcttatgcccccgggggctccagagctgtgctacgccggaac
cccaacttcacctgtgagctaaagcaggcaagtgatcgtggctgcaatcgcatgtctgcc
tttgtggacagcgccaccttctgttcagctccaacaagacagattgccaagaagctgctc
catgaggagctggctctgcagtgggtggtgagcaccagcacagtgagggaggcagcactg
caacaggcctggttcttcttccaactcatgacgaagagtatgtcccaccacctgttcctg
tcctcccggatagaccttcccagacgccagcgcttcccagaccgctttgtggatgacatc
gctgctctagtgggtgctatcagtgctgatgtagcagggcgataccacaaggatgtggag
cttgtggagaggttgaacagcagtctggccttcttcctgaatgacctgctgtctctcatg
gaccgtggctttgtcttcaacctcatccgctcctactacaaacagattgccaacaagttc
cacacagcccagaaccccagctctctgactgctctgagaatggacttcacccgcattttg
tgcagccatgagcactatgtcaccctcaacctaccctgctccaccctcagccctcccgcc
tcgccctccccctccacctcctccaccacctcccagggctcagcgttctccagtatgcac
caggaccagggtgtggccagtatgtttgagctctctgtccccttcagacagcaacacttc
ctgtctggcctgctactgactgaactatccctcatcctggagcctgatggggagggggtg
tttttcctgcataagaaggccatcagtgcagtccactctctgatgagcagtcatgatgcg
gaccctcgctacacggacccccaggtgcgaacccacatcgcccagctctacctgcccctc
atccccatcgtcatggacaccctgccccagctccatgacttcacagacacttctcaagcc
cggggccgccacgcccccgctatgcaagacgacggggacccagacaacggaaccatcagt
caatctgtcgccatggcgatcgctggctccccgctgccgcatgccaaagcccccaacttc
accatgcccacggtggctggtcgtcagtgcagctctctgtcggcagagtgcagtaggact
ctgctggtgtctttcctgtgggttctgaagaacgcagacgctgctctgctggagagctgg
gtgtcagacctctctgtgatgcagatcaacaggctgctagacctgctgcacctctcggtg
tcctgcttcgagtacaaggggaagaaggctctggagcgtatcaacagcctgacgtttaag
aaatctcaggacatgaaggctcgtctggaggaggccatactgggaaccatcggagcccga
caggagatggtccgtcgctgcagagagcggagtccgtatggcaatgagaacgtcagatgg
aggaagaacgtcactcactggagacagaacacagacagagtcaacaaaactaaagcggag
acagagcaggagtccgtggtggatggaaacctggccactgaagcctctctggtcgtcctg
gacacgctggagatcatagtgaagacggtgctggtgtcagagctgaaggagagtgttttg
ggcggggtgttgagagtcctcctccacagcatggcagggagtcagagtgccctcttcctg
cagcactgcttcactacacagaggggactggtcttcaagttcccagagatgctgtttgag
gaggacacagagctgtgtgctgacctgtgtctacgtctgctccgccactgcagcagcagt
gtggggtctgtccggagtcaagcctccgcctccctctacctgctgatgaggcagaacttc
gagatcggcaacaactttgctcgggtgaagatgcaggtcaccatgtccctgtcctccctg
gtggggacatctcagaacttcaacgaggagcacctccgacgttccctaaaaaccatcctg
acctacgcagaggaggacctggagctacgggactccccgttcccagaacaggtccaggat
ctggtcttcaatctgcacatgattctgactgacacagtcaagatgaaggagcaccagcag
gaccctgagatgctcattgatctcatgtacaggattgctaagggctaccagaactcccct
gacctgcgcctgacgtggctgcagaacatggcggggaagcactcggagagagggaaccac
gcggaggcagcccactgcctggtgcacagcgccgccctggtggcagagtacctcaacatg
ctggaggactgccgctacatgcccattggctgtgtcaccttccagcacatctcgtctaat
gttctggaggagtcagcggtgtctgatgacatcctgtccccagaggaggagggtatctgc
gcggggaagtacttcagcgagttggggctggtgggactgctggagcaagctgcaacctcc
ttccacatggcttccatgtacgaggccatcaacgaggtgtataagatcctgctcccggtc
cacgaggccaacagagacttcaagaagctggctactgtccatggaaagttgcaggacacc
tttaacaaaatctacaaccagagttctggatgggagaggatgtttgggacctacttccgg
gtgggcttctacggctgtcgctttggggacctggatgagcaggagtttgtgtacaaggag
ccctctatcaccaagctggctgagatctcctacagactagaggagttctatgctgagcgg
tttggagatgatgtggtggagattatcaaggactccaaccatgtggacaagaacaagctg
gaccccaataaggcctacctccagatcacctacgtggagcccttcttcgacacgtacgag
ctgaaggagaggatcacctacttcgacaagaactacaacctgcgcaccttcatgtactgc
acccccttcaccctggacgggcgcgcccacggggacctgcacgagcagtacaaacgcaag
tccatcctcaccacgtcccacgctttcccctacatcaagacacgcataaacgtcatccac
aaagaggagatcatcctggtgcccatggaggtggctatagaggacatgcagaagaagacc
caggagctggccttcgctacccaccaggagcctgccgacgccaagatgctgcagatggtg
ctgcagggctccgtgggcaccactgtcaaccagggccctctggaggtggcccaggtcttt
ctctctgacattcctgatgaccccaagctgtaccgtcatcacaacaagctacgcctctgc
tttaaagacttcactaagaggtgtgaggatgccctgaggaggaacaagactctgattggt
ccagaccagaaagagtaccacaaggaaatggagaggaactacaataagctgaaagagtct
ctgggaccgctcatcacccgcaagatcccccagctctacagaacactgccggctgcaggg
cttcagtctgctacacaaaggttacaaatcaaagaaattccttcagtagttccagtctcc
gccggggggactgttgaagcacagcagacctcgtcaacggagaagaaaccgagagcttga

DBGET integrated database retrieval system