KEGG   Salmo salar (Atlantic salmon): 106602756Help
Entry
106602756         CDS       T04363                                 

Gene name
SUCA
Definition
(RefSeq) succinyl-CoA ligase subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00020  Citrate cycle (TCA cycle)
sasa00640  Propanoate metabolism
sasa01100  Metabolic pathways
sasa01200  Carbon metabolism
Module
sasa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sasa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106602756 (SUCA)
   00640 Propanoate metabolism
    106602756 (SUCA)
Enzymes [BR:sasa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     106602756 (SUCA)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     106602756 (SUCA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 106602756
NCBI-ProteinID: XP_014051070
UniProt: A0A1S3RFI8
Position
ssa04
AA seq 324 aa AA seqDB search
MSHSRLFARLLLQQNGVRSCYTASRKNLYIDKDTKVICQGFTGKQGTFHSQQAIDYGSRL
VGGVSPGKGGRTHLGVPVFNSVKEAREGTGAEATVIYVPPPFAGAAIIEAIDAGMPLVVC
ITEGIPQQDMVKVKHKLLRQSTTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRS
GTLTYEAVHQTTQVGLGQSLCIGIGGDPFNGTNFIDCLEVFLQDPKTDGIILIGEIGGNA
EENAADYLKQHNSGANAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKIAALQQAG
VVVSMSPAQLGSTMFKEFEKRKML
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcatagtagattgtttgcccggctgctcttgcagcaaaatggagtaaggagctgt
tatactgcttcaagaaagaacctctacattgataaagacaccaaggtcatttgccaaggc
ttcacagggaagcaggggacgtttcacagtcagcaggcaatcgactatggctcccggcta
gtcggtggcgtatcccccggcaagggggggaggacacacctcggcgtgcccgtcttcaac
tctgtcaaggaggcgagagagggcaccggggcagaggccacagtgatctatgtgccccct
ccgttcgcgggtgccgccatcatcgaggccattgacgccggcatgcccctggtggtgtgc
atcacagagggcatcccccagcaggacatggtcaaggtcaaacacaagctgctgcgccag
agcaccacccgcctcatcggccccaactgccccggagttattaatccgggagaatgcaag
atcgggatcatgccgggccacattcacaagaaaggaaggattggcattgtctcaaggtca
ggaactctcacatacgaagctgtgcaccagactacacaagttggcctgggacagtctctc
tgcatcggcatcggtggggaccccttcaatgggacaaatttcatcgactgcctggaggtg
ttcctgcaggaccccaagacggacggcatcatcctgatcggagagatcggaggcaacgcc
gaggagaacgctgccgattacctcaaacagcacaactctggagcgaatgccaagcctgtg
gtgtctttcatcgctgggctcactgccccgccgggccgtaggatgggtcacgccggtgcc
atcatcgcagggggcaagggcggagccaaagagaagattgccgccctacagcaggcgggc
gttgtggtcagcatgtcccccgcccagctgggcagcaccatgttcaaggagtttgagaag
aggaagatgttgtaa

DBGET integrated database retrieval system