KEGG   Salmo salar (Atlantic salmon): 106602935Help
Entry
106602935         CDS       T04363                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit alpha
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04020  Calcium signaling pathway
sasa04114  Oocyte meiosis
sasa04217  Necroptosis
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04310  Wnt signaling pathway
sasa04912  GnRH signaling pathway
sasa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106602935
   04310 Wnt signaling pathway
    106602935
   04020 Calcium signaling pathway
    106602935
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    106602935
   04217 Necroptosis
    106602935
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    106602935
   04916 Melanogenesis
    106602935
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106602935
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106602935
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     106602935
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   106602935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 Pkinase_fungal APH Kdo SnoaL_2 SnoaL_4
Motif
Other DBs
NCBI-GeneID: 106602935
NCBI-ProteinID: XP_014051432
UniProt: A0A1S3RHV5
Position
ssa04
AA seq 488 aa AA seqDB search
MATITCTRFTEEFQMFEELGKGAFSVVRRCVKVLSGQEYAAKIINTKKLSARDHQKLDRE
ARICRLLKHSNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKAVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPAKRITASEVLKHPWISHRSTVASCMHRQETVECLKKFNARRKLK
GAILTTMLATRNFSGGNKANKKTDGVKKRKSSSSVQLMESSESTNTTIEDEDTRVRKQEI
IKVTEQLIEAISNGDFESYTKMCDPSVTAFEPEALGNLVEGLDFHRFYFENLWSKNSKPV
HTTILNPHIHLIGEEAACIAYIRITQYIDTNGMPRTAQSEETRIWHRRDGKWQIVHFHRS
GSPSAITN
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggccaccattacctgcacccgcttcactgaggaattccagatgtttgaggaactgggc
aagggagctttttctgtggtgcgtagatgcgtcaaggtcctctcagggcaagagtatgct
gctaagatcatcaacaccaagaagctttctgccagggatcaccagaagctggacagagag
gccaggatctgccgactgctgaagcactcaaacatcgtgcgtctccatgacagcatctca
gaggaggggcatcactacctgatctttgacctagtgacaggcggggagctctttgaagac
attgttgctcgagagtactacagcgaggccgacgccagtcattgtattcagcagattctg
gaggcagtgcttcattgtcatcagatgggagtcgttcacagagacctgaagcctgagaac
cttctgcttgcctccaagtccaagggtgctgcagtgaagctggcagacttcggcctggcc
atcgaggttgagggggaacaacaagcctggttcggctttgcagggacacctggctacctt
tctcctgaggttctgaggaaggacccatatggcaaagctgtggacctgtgggcttgtggt
gtgatcctgtacatcttgctggtgggctaccctccgttctgggatgaggatcagcacaga
ctgtaccagcagatcaaggctggggcctacgatttcccctcgccggagtgggacactgtt
actccagaggcgaaggatctcattaacaaaatgttgacgatcaaccctgccaagcgcatc
acagcctctgaggtcctcaagcacccgtggatctcacaccgctccactgtggcctcctgc
atgcacagacaggagacggtggaatgcctgaaaaagttcaacgccagaagaaagctgaag
ggtgccattctcaccaccatgttggcgacccggaacttctccggaggtaacaaggccaac
aagaagacggatggtgtgaagaaaaggaagtccagttccagcgtccagctgatggaatcc
tctgaaagcaccaacaccactattgaggatgaagacaccagagtgaggaaacaggagatc
attaaggtgacagagcagcttatagaagccatcagcaatggagacttcgagagctacacg
aagatgtgtgaccccagtgtgacagcgtttgagccagaggctctgggtaacctggtggag
ggcctggacttccaccgcttttactttgagaacttgtggtctaagaacagtaagcctgtc
cacaccaccatcctgaacccccacatccacctgatcggggaggaagccgcctgcatcgcc
tacatccgcatcacccaatacatcgacaccaacggcatgccccgcaccgcccagtctgag
gagacacgcatctggcaccgccgcgacggcaagtggcagatagtccacttccatcgctct
ggatcaccctccgccatcaccaactga

DBGET integrated database retrieval system