KEGG   Salmo salar (Atlantic salmon): 106603047Help
Entry
106603047         CDS       T04363                                 

Definition
(RefSeq) beta-1,4-galactosyltransferase 4-like
  KO
K07969  beta-1,4-galactosyltransferase 4 [EC:2.4.1.90 2.4.1.275 2.4.1.-]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00533  Glycosaminoglycan biosynthesis - keratan sulfate
sasa00601  Glycosphingolipid biosynthesis - lacto and neolacto series
sasa01100  Metabolic pathways
Module
sasa_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    106603047
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    106603047
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sasa01003]
    106603047
Enzymes [BR:sasa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.90  N-acetyllactosamine synthase
     106603047
    2.4.1.275  neolactotriaosylceramide beta-1,4-galactosyltransferase
     106603047
    2.4.1.-  
     106603047
Glycosyltransferases [BR:sasa01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   106603047
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 106603047
NCBI-ProteinID: XP_014051653
UniProt: A0A1S3RH87
Position
ssa04
AA seq 355 aa AA seqDB search
MGVCPAVSRYFRRWKYMILLLLSVSVLAWLATFAGETVKSIQDTHRSAQTLEDNAEVLRG
GMQYSWKTVTQVFSNPLPDTPPPKESCPEKSPLLHGALKLTFEDSLTLKEVESENSGVAE
GQYQPPDCLAQQSVAILIPHRNREKHLLYLLHHLHPFLQRQQLRYGIYVIHQAGEVTFNR
AKLLNVGYLEALKDYDWDCFVFHDVDLVPENDYNLYKCDQQPKHLVVGRNATGYKLRYKG
YFGGVTAMTKDQFHKVNGFSNTYWGWGGEDDDLRIRVELQKMKIIRPPPLIARYTMVFHK
RDSGNEINKDRMLLLGRTPQVWRTDGLNTCSYSTLSVERPPLYINVTVDIGKPLH
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgggagtctgtcctgctgtgtccaggtacttccggaggtggaagtatatgatactgttg
ctgctgtcagtctccgttttggcttggctcgccacttttgccggcgaaaccgtgaaatca
attcaggatacccataggtcagcacagacacttgaggataacgctgaggtcctgaggggg
ggcatgcaatactcatggaaaacagtgacgcaagtcttctccaatcctctccctgacacc
ccaccaccaaaagaaagctgtcctgagaaatcaccactgcttcacggagccctgaagctg
acattcgaggactctctaacgctgaaggaggtggagagtgagaacagcggagtggctgag
ggccaataccagcctccagactgcctcgcccagcagagtgtggccatcctcatccctcac
cgtaaccgggagaaacacctcctctacctcctgcatcacctgcaccctttccttcagagg
cagcagctgcgctacggcatctatgtcatccaccaggctggagaggtgacgtttaatcgt
gccaagctacttaatgtggggtacttggaggcactcaaggactacgattgggattgcttc
gtttttcacgatgtggatctggttccagagaacgactacaacctatacaagtgtgaccaa
cagcccaaacacttagtggtcggtaggaacgccacaggatacaaattgcgatacaaaggg
tactttggaggggtgacggccatgacgaaggaccagtttcacaaagtgaacggcttttca
aacacttactggggatggggtggggaggatgatgatcttcgcatcagggtggagctccag
aaaatgaagattatacggccaccccctcttatagcacgctataccatggtatttcataaa
agagatagcggcaacgaaattaataaagaccggatgctcttgctaggacggacacctcaa
gtctggagaacggatggccttaacacctgctcctacagtactctctcagttgagaggcca
cctctgtacattaatgtcacagtggacattggcaaaccactgcactga

DBGET integrated database retrieval system