KEGG   Salmo salar (Atlantic salmon): 106603135
Entry
106603135         CDS       T04363                                 

Gene name
tm7sf2
Definition
(RefSeq) transmembrane 7 superfamily member 2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00100  Steroid biosynthesis
sasa01100  Metabolic pathways
Module
sasa_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    106603135 (tm7sf2)
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     106603135 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 PEMT DUF1295 ICMT
Other DBs
NCBI-GeneID: 106603135
NCBI-ProteinID: XP_014051891
UniProt: A0A1S3RI45
Position
ssa04
AA seq 420 aa
MKFNKQKSPHAEKEFGGTLGATCIPVFLPLTVLYLLCVCRSPAASVLQWPPVLPPTAQLW
DPLAPVLILGWMALQSFFYLLPMGKVSEGMVLKDGSRLKYPINGFHALCVTAVLLTLSLW
LGMPLGYLFELLLPLAVCAIGVSFLLSLYLYICSFWAPHHALAQGGNTGNPLYDFFMGRE
LNPRIGSFDLKYFCELRPGLIGWVVINLGMLMKEVELRDSASLAMILVNSFQLLYVADAL
WNEEAVLTTMDIVHDGFGFMLVFGDLAWVPFTYSLQAAFLVVHPQSLSLLGATAIVTLNG
AGYYIFRKSNSQKNQFRRDPTHPSVANLETIATATGKRLLVSGWWGLVRHPNYLGDLLMA
LAWSLPCGFNHLLPYFYVVYFTILLIHREARDERHCRAKYGLAWDSYCRRVPYRIFPYIY
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgaagttcaacaaacaaaaatccccacacgcagaaaaggaatttggggggactttgggt
gccacctgtatccctgtcttcttgcccctgacggtactttacctgctctgtgtatgtcgc
tcccctgcggccagcgtgctccagtggccccctgtcctgccccccacagcccagctatgg
gaccccctggcccctgttctcatactgggctggatggccctccagagcttcttttacctg
ctgcctatggggaaggtgtctgaggggatggtgctaaaagatggctcgagactcaagtac
cccataaacggttttcatgccctttgcgtcacagctgtgctgttgacattgtcactatgg
ctggggatgcctctggggtatctctttgagctgttgttgcccctggcagtgtgtgctatt
ggggtgtcattcctcctctccctctacctctacatctgctccttctgggcccctcaccat
gcccttgcccaggggggaaacacaggaaaccccctgtatgatttctttatgggccgagag
ctgaacccacggattggaagctttgacctgaaatatttttgtgagctgagaccaggtctg
attggctgggtggtgattaaccttgggatgctaatgaaagaggtggagctacgggactcc
gcctccctggccatgatactggtcaacagcttccagctgctctacgtggcggatgctctg
tggaatgaggaggctgtgctgaccaccatggacatagtgcatgatggctttgggtttatg
ttggtctttggggacctggcttgggttccctttacgtacagcctgcaagctgccttcctg
gtcgtgcacccacagtcccttagtcttctaggagccacagctatagtcacattgaatggt
gctgggtattatatcttcagaaaatcaaactcccagaagaaccaattcagacgggaccct
acgcatcccagtgttgcaaacctggagactattgccacagcaactgggaagcgccttttg
gtgtctggctggtggggcctcgtacgccatcctaactacctgggagaccttctcatggcc
ctggcatggtccctgccatgtggattcaaccatcttctaccttacttttatgttgtgtac
ttcactatcctgttgattcaccgagaggcccgtgacgagaggcactgcagggccaagtat
ggcctggcatgggacagctactgcagacgcgtgccctacaggatcttcccctatatctac
tga

DBGET integrated database retrieval system