KEGG   Salmo salar (Atlantic salmon): 106603918
Entry
106603918         CDS       T04363                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00230  Purine metabolism
sasa00240  Pyrimidine metabolism
sasa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106603918
   00240 Pyrimidine metabolism
    106603918
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     106603918
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_28 Thymidylate_kin AAA_17 Cloacin_immun
Other DBs
NCBI-GeneID: 106603918
NCBI-ProteinID: XP_014053624
UniProt: A0A1S3RPI9
Position
ssa04
AA seq 264 aa
MATPPKRICSSPGFDNSFEKRTKKISIEGNIAAGKSTLVHILEKSSEEWEVIPEPIGKWC
NVQNTDNEYKELSTSQKSGGNLLQMLYDKPSRWSYTFQSYACLSRVRAQLQPPSAKLQQA
EKPVQFFERSVYSDRYVFASNLFESGDMNETEWDIYQDWHSWLLSQFESQIELDAMIYLR
ADPQRCMQRLHCRGREEEQGIPIDYLEQLHYKHECWLYHRSTQLAFEYLKDVPILVLDVN
DDFKNDQIKQEAVLDKVREFLSTL
NT seq 795 nt   +upstreamnt  +downstreamnt
atggcaacacctcctaagagaatatgttcaagtccaggttttgacaacagttttgagaaa
agaactaagaagatatccattgaaggaaacattgctgcagggaagtctacattagtgcac
attttagaaaaatcttcagaagaatgggaggtcataccggagcccattgggaagtggtgc
aacgttcaaaacactgacaatgagtataaggagctcagcacatctcagaagagtggaggc
aacctgctgcagatgctgtatgacaaacctagccgctggtcctacacattccagagttac
gcctgtctgagtcgtgtgcgcgctcagctgcagcccccttctgcaaagttgcaacaggca
gagaaaccggtccagttctttgagcgctctgtttacagtgaccggtatgtatttgcctcc
aacctatttgagtctggggacatgaatgagaccgaatgggacatttaccaagactggcac
agttggctgctctctcagtttgagtctcaaattgagctggatgccatgatctaccttcgg
gctgacccacagagatgtatgcagaggctgcactgccgaggacgggaggaggaacaagga
attccaattgactatctggagcaactgcactataagcacgagtgctggctgtaccaccgc
agtactcaacttgcttttgagtacctgaaagatgtccccatcctggtcctggatgttaat
gacgacttcaagaatgatcaaattaaacaggaagctgtgctggacaaggtcagagaattc
ctcagcacgctgtga

DBGET integrated database retrieval system