KEGG   Salmo salar (Atlantic salmon): 106603924Help
Entry
106603924         CDS       T04363                                 

Definition
(RefSeq) glutamate receptor 1-like
  KO
K05197  glutamate receptor 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106603924
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sasa04040]
    106603924
Ion channels [BR:sasa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   106603924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF2061
Motif
Other DBs
NCBI-GeneID: 106603924
NCBI-ProteinID: XP_014053648
UniProt: A0A1S3RMZ7
Position
ssa04
AA seq 936 aa AA seqDB search
MQRRLTLAFVSFCVGFCSGSSFPSNINIGGLFPNASHEYEVFRFALSHHQDIPKLVPQVD
MVDTASSFAMTYAFCSQFSKGVYAIIGLYDRKTMNMLMSFCGALHVCFVTPSFPIETNNQ
FVIQLRPELQEPLIALIQHYKWTKFVYMYSSHSGLTVLQKILDTAAEKTWQVTSVNLDSG
MDQVGFLKVVQDLEKKKEYNIILDCELERLNLILNLIAAQKKNLKNYHYILANLGFLDMN
FTEFQKSGANITGFQLMNYSDENVNKAIEEWVDFDSKDLKLPKRRLKYTGALTYDGVSVM
ATAFQNLRKQRIDISRRGNAGECLANPPAPWGQGIDIQRALQQVRIEGLTGHVQFNEKGH
RINYTVSVMELSPSGPLKVGYWNENENYVNTAVYTPVVEEFFGLQNRTYIVTSILESPYV
MLKKNHEQLVGNDKYEGYCVELAAEIAKHVGYTYKLEIVGDGKYGARDAESKMWNGMVGE
LVYGKADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPTKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWQGDDSEGEEGQEQQQRQQSSSPRREPGQSQSQPGQ
NQGQGQGQSQSQPGQNQGQGQGQSQNEGHTNEFGIFNSLWFSLGAFMQQGCDISPRSLSG
RIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDGGSTKEF
FRRSKIAVFEKMWSYMKSADPSVFVKTTDEGVVRVRKSKGRYAYLLESTMNEYIEQRKPC
DTMKVGGNLDSKGYGVATPKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGG
DSKDKTSALSLSNVAGVFYILIGGLGLAMLVALVEFCYKSRIESRRMKQIIDAAMLSSTL
SRMTRTGSGGENGRVVAHDFPKASQTLPCMSQAAGM
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagacttaccttggcctttgttagtttttgtgttgggttttgctctggttca
agtttcccaagtaatataaatatagggggattgttcccaaacgcctcccacgaatatgag
gtttttcggtttgcactctctcatcaccaggatatccccaaactggtaccacaagtggac
atggtcgacacagcaagcagctttgctatgacatatgcattttgttcacagttttccaaa
ggagtctatgccatcattggattgtatgacaggaagaccatgaacatgctcatgtcgttc
tgcggggctctccacgtctgctttgtgacacccagtttcccaattgaaaccaacaaccag
tttgtcatccagctcagaccggagcttcaggagcccctcattgccctgatccagcactac
aaatggaccaagtttgtctacatgtatagctctcattcaggcctgacagtgctgcagaag
attctggatacggcggcagagaagacgtggcaggtgacatcagtgaacctggacagtggt
atggatcaggtgggcttcctgaaggtggttcaggacctagagaagaagaaggagtacaac
atcatcctggactgtgagctggagagactcaacttgatcctcaacctgatcgctgctcag
aagaagaacctgaaaaattaccactacatattggcaaacctgggatttttggacatgaat
ttcactgagttccagaagagtggtgccaacatcaccgggttccaactaatgaactactca
gacgaaaatgtcaacaaggccatagaggagtgggtggactttgacagcaaagaccttaag
ctacccaagagaagactgaagtacacaggagccctcacatacgacggagtgagcgtcatg
gcaaccgcctttcagaacctccggaagcagcgtattgacatctcccggcgaggcaacgct
ggcgagtgtctggccaacccaccagctccctggggccagggtatcgacatccagagagcc
ctacagcaggttcgaattgagggcttgactggacatgtccagtttaacgagaaaggccat
cggatcaactacacggtcagcgtcatggagctgagcccgagtggaccgctgaaggtgggc
tactggaacgagaatgagaactatgtgaacacagcggtatacacaccggtggttgaagaa
ttcttcggactgcaaaacaggacctacatagtgaccagtatccttgaatctccatatgtg
atgctgaagaagaatcatgagcagctggtggggaacgataagtatgagggctattgtgtg
gagctggccgcggagatcgccaagcatgtgggctatacttataaactggagatcgtaggg
gatggcaagtatggagccagagacgctgagtccaagatgtggaatgggatggtgggcgag
ctcgtttatgggaaagcagacgtagcagtagccccgttgaccatcaccttggtgagagag
gaggtgatcgacttctccaagcccttcatgtccctgggcatctccatcatgatcaagaag
cccaccaagtcaaaacctggagtcttctccttcctcgacccactggcctacgagatctgg
atgtgcatcgtgtttgcctacatcggtgtgagcgtggttctcttcctggtcagccgcttt
agcccgtacgagtggcagggggacgactcagagggagaggagggccaagagcagcagcag
agacagcagtcgtccagtcccaggagagagccaggacagtcccagtcccaaccgggccaa
aaccagggccaaggacagggccagtcccagtcccaaccgggccaaaaccagggccaagga
cagggccagagtcagaatgaggggcacaccaatgagtttgggatattcaacagcttgtgg
ttctcgctgggtgccttcatgcagcagggctgtgacatctcgccaaggtccctctctggt
cgcattgtagggggagtgtggtggttcttcaccctcatcatcatctcctcctacacggcc
aacctggctgccttcctcaccgtggagaggatggtgtcgcccatagagagtgctgaggac
ctggccaagcagacagagatcgcctatggtactctagacggaggctccaccaaagagttc
ttcaggagatcgaaaatcgccgtattcgagaagatgtggtcctacatgaagtccgctgac
ccgtcagtgttcgtgaagaccacagacgagggcgtggtgcgggtcaggaagtccaaaggg
aggtatgcctacctgctggagtccaccatgaacgagtacatcgagcagaggaaaccctgt
gacaccatgaaggtcggggggaacctggactccaagggttacggagtggccacgcccaag
ggatcagcactaagaaacccagtaaacttggcagtgttaaaactgaacgagcagggcctg
ttggacaaattgaaaaacaaatggtggtacgacaagggcgagtgcggcagcgggggaggt
gattccaaggacaagaccagtgctctaagcctcagcaatgtggctggggtgttctacatc
ctgattggagggctggggctggccatgctcgtggccttggtcgagttctgttacaagtcc
aggatcgagtcgaggaggatgaagcaaatcatcgatgcagccatgctgagttccaccctg
agccggatgaccaggacagggagcgggggcgagaatggacgagtggtcgcccatgacttc
cccaaagcgtcacagactctcccctgcatgagccaggccgcgggcatgtga

DBGET integrated database retrieval system