KEGG   Salmo salar (Atlantic salmon): 106604392Help
Entry
106604392         CDS       T04363                                 

Definition
(RefSeq) transforming growth factor beta-2-like
  KO
K13376  transforming growth factor beta-2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04060  Cytokine-cytokine receptor interaction
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04218  Cellular senescence
sasa04350  TGF-beta signaling pathway
sasa04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106604392
   04350 TGF-beta signaling pathway
    106604392
   04068 FoxO signaling pathway
    106604392
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106604392
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106604392
   04218 Cellular senescence
    106604392
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    106604392
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sasa04052]
    106604392
   00536 Glycosaminoglycan binding proteins [BR:sasa00536]
    106604392
Cytokines and growth factors [BR:sasa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   106604392
Glycosaminoglycan binding proteins [BR:sasa00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   106604392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta Mito_fiss_reg
Motif
Other DBs
NCBI-GeneID: 106604392
NCBI-ProteinID: XP_014054443
UniProt: A0A1S3RQB2
Position
ssa05
AA seq 433 aa AA seqDB search
MEPSESVHQSDHRTMWLTHLALLLLRLAVSAEGLSTCQSFSLDDQKSKRIEAVRGQILSK
LRYRSPPEPPAPSPQPETVPAEVMLLYNSTRELLKERARQAESACDRESSEEDYYAKEVQ
RIDMLPQRTDINAVNPPIPSPYYRVVGFDVSGVDRNSSTLVKAEFRIYRAPNPQARTSEQ
RVEIYQVIKPEEPTGPTQRYIDSRTVRPRTKGAWLSVDVTDTVKDWLAHKERNLGLKLGV
HCPCCTFVPSTNSIVFNKSEQLETRFAGLDDELHQQQVWKPGAGMAKGQVEFSTKTPHLI
LTLLPSDRVDNPGKKTRKRRAAADTTTCSRNSGAGCCLRSLYIDFRRDLNWKWIHEPKGY
KANFCSGSCPYLWSADNHYNMILPLYNKLNPEASASPCCVPQDLEPLTIVYFMGRTPKVE
QLSNMVVRSCKCR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggagccgagtgagtccgttcaccaatctgaccaccggactatgtggctcacccacctc
gccttgctgctgctccggctggcggtgtccgcggaggggctctccacctgccaatcattc
agcctggatgatcagaagtccaagcgcatcgaggccgttcggggtcagatcctcagcaag
ctccgctaccggagcccaccggagccccccgcaccgagcccacagcccgagactgtgccc
gccgaggtgatgctgctctacaacagcactcgggagctgctgaaggagcgtgcgcgccag
gccgagtccgcgtgcgaccgggagagcagcgaggaggattattatgcaaaagaggttcag
cgcatagacatgcttccgcagcgcacagacatcaatgcagtgaaccctccaattcccagc
ccatattacagagtggtggggttcgatgtgagtggtgtggacaggaactccagcaccctg
gtcaaagccgagttcagaatctacagagcacccaacccccaggcccgcacctcagagcag
agagtagagatctatcaggtgataaagccagaagagccaacaggccccacgcagagatac
atcgattccagaactgttcgcccacggaccaagggggcgtggctctctgtggatgtcaca
gacactgtgaaggactggctggctcataaggagaggaacctgggtttgaagctgggtgtt
cactgtccgtgctgcaccttcgttccctccaccaacagcatcgtgttcaataagagtgag
cagctggagacgcgcttcgcaggcctggatgatgagctgcatcagcagcaggtgtggaag
ccgggggcaggcatggctaagggccaggtagagtttagtaccaagaccccccacctcatc
ctcaccctgctgcccagtgacagggtagacaacccgggcaagaagacccgcaagaggagg
gccgctgcagacaccaccacctgctccaggaattcaggcgcgggctgctgtctgcgatcg
ctctacatcgacttccgccgggacctgaactggaagtggatccacgagccgaagggctac
aaggccaatttctgctctggcagctgcccatacctctggagcgctgacaaccactacaac
atgatcctgccgctgtataacaagctgaaccctgaggcgtcggcatctccgtgctgcgta
cctcaggacctggagcctctgaccatcgtttacttcatgggccgaacgcccaaggtagag
cagctctccaacatggtggtcaggtcctgcaagtgccgctga

DBGET integrated database retrieval system