KEGG   Salmo salar (Atlantic salmon): 106604536Help
Entry
106604536         CDS       T04363                                 

Definition
(RefSeq) dihydropteridine reductase-like
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00790  Folate biosynthesis
sasa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    106604536
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     106604536
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 Epimerase Peptidase_S66 3HCDH_N HTH_IclR RmlD_sub_bind
Motif
Other DBs
NCBI-GeneID: 106604536
NCBI-ProteinID: XP_014054731
UniProt: A0A1S3RQX3
Position
ssa05
AA seq 236 aa AA seqDB search
MAASRVLVYGGRGALGSKIVQHFKSKGWWVASIDIVASEEANANVLVKLSESFTEQAGQV
TADVAQLLGDQKVDAILCVAGGWAGGNCRSKDLYKNTDMMWKQSVWTSTISSHLAAVHLK
QGGLLTLAGAKASLGGTSGMVGYGMAKSAVHQLCQSLAGEDSGMPLGAVTVAILPVTLDT
PMNRKFMPDADFGSWTPLEYIAETFFSWATGADRPASGSLMQLTTTGGKTQALPTQ
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggctgccagtcgggtactcgtatacgggggaagaggtgcactgggtagcaaaattgtt
cagcactttaaatctaaaggatggtgggtagccagcatcgacatcgttgccagtgaggag
gcaaacgcgaacgtgctggtgaagttgtccgagtcatttaccgagcaagcaggacaggtg
acagcagatgtggcccagttgctaggggaccagaaagttgatgccatcttgtgtgtggca
ggcggatgggctggaggaaattgcaggtccaaagacctgtacaaaaacacagacatgatg
tggaagcagagtgtgtggacctctaccatatctagccacctggctgctgtgcacctgaag
cagggtggactactgactctggctggggctaaagcatcactgggtggtactagtggcatg
gtgggctatggcatggccaagtcagcagtccaccaactctgtcagagtctagcaggagaa
gacagtgggatgccccttggagctgtgactgttgccatactaccggtaaccttggatact
ccaatgaacaggaagttcatgcctgatgcagactttggttcctggacaccactggagtac
attgcagaaactttcttcagttgggccaccggtgcggatcgtccagcatcgggcagtctg
atgcagctcaccaccactggaggcaagacacaggccctacccacacaataa

DBGET integrated database retrieval system