KEGG   Salmo salar (Atlantic salmon): 106605262Help
Entry
106605262         CDS       T04363                                 

Definition
(RefSeq) septin-7
  KO
K16944  septin 7
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106605262
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sasa04812]
    106605262
   04147 Exosome [BR:sasa04147]
    106605262
Membrane trafficking [BR:sasa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    106605262
Cytoskeleton proteins [BR:sasa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     106605262
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106605262
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 Ras AAA_22 FeoB_N AAA_16 AAA_29 Roc ABC_tran AAA_7 Gtr1_RagA
Motif
Other DBs
NCBI-GeneID: 106605262
NCBI-ProteinID: XP_014056181
UniProt: A0A1S3RV69
Position
ssa05
AA seq 426 aa AA seqDB search
MAQQKNLEGYVGFASLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSSEY
PGPSHRVKKTVQVEQSKVLVKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDHIDSKFED
YLNCESRVNRRLMPDSRVQCCLYFITPSGHGLKPLDIEFMKRLHEKVNVIPLIAKADTLT
PEECQRFKKQIMREILEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGK
RTRGRQYPWGVAEVENGDHCDFTILRDMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN
GQDNNRVKGQQSTKHDTGEGMSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKIQKL
KDSEAELSRRHEQMKKNLEAQHKELEEKRRQFEDDRANWEANQRLEQQRLDASRTLEKNK
KKGKIF
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggctcaacaaaagaatctggaggggtatgtgggctttgctagccttcccaaccaagtg
tacaggaagtcggtgaagagaggctttgaattcaccctgatggttgtgggtgaatcagga
ttgggcaagtccacgttgatcaactctctgttcctaacagacttgtactcgtcagaatac
cctgggccttcgcacagagtcaaaaagactgtacaggtggagcaatccaaagtgttagta
aaggaaggtggtgttcagctcctgctcacaatagtcgacaccccaggattcggcgacgct
gtggacaatagcaactgctggcagccggtcatcgaccacatagacagcaagtttgaggat
tacctcaactgtgagtcgcgggtgaacagacgactgatgcccgacagcagagtgcagtgc
tgcctctacttcatcaccccctcgggacacggactgaagcctctggatattgagtttatg
aaacggttgcatgagaaggtgaacgtcatcccactgatcgcgaaagcagacactctcacc
ccagaggagtgccaacggttcaagaagcagatcatgcgggaaatcctggaacacaaaatc
aagatctacgagttcccagagacggatgatgaggaagagaacaaactggtgaagaagatc
aaggaccgtttgcccctggccgtggtgggcagtaacaccatcatcgaggtgaacgggaag
aggaccagaggacgacagtacccatggggagtggcagaagttgagaacggagaccactgt
gatttcaccatcctacgagacatgctcatcagaacccacatgcaggacctgaaggacgtg
accaataacgtccactatgagaactaccgtagcaggaagctggcggccgtcacctacaac
ggacaggacaacaacagggtcaagggtcaacagtcgacgaaacatgacacaggtgaaggc
atgagccccctggctcagatggaggaggagcggcgggagcacgtggccaagatgaagaag
atggagatggaaatggaacaggtgtttgagatgaaggtcaaggagaagatccagaagctg
aaagattccgaggctgagctgtcgaggcgtcatgagcagatgaagaagaatctggaggcc
cagcacaaggagctggaggagaagagacgccagtttgaggatgaccgggccaactgggag
gccaatcagcgtctggagcaacagagactggatgcctccaggactctggaaaagaacaaa
aagaaggggaagatattttag

DBGET integrated database retrieval system