KEGG   Salmo salar (Atlantic salmon): 106605280Help
Entry
106605280         CDS       T04363                                 

Definition
(RefSeq) deoxyribonuclease-2-alpha-like
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    106605280
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     106605280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNase_II DUF3699
Motif
Other DBs
NCBI-GeneID: 106605280
NCBI-ProteinID: XP_014056218
UniProt: A0A1S3RVA2
Position
ssa05
AA seq 391 aa AA seqDB search
MLSLVVLLILFQPGEGGTSPISCYNDQGEAVDWFYLYKLPHVDREFPNDGQSYLLMDKGS
EGWTDGNVLVNDSTGALGRTVGQLYEQGKNADIAYILYNDQRPPEEGERGFGFLSNRGGH
TKGVVLLDKTQGYWLVHSTPHFPPVKEIGQYSYPGSGVQNGQNFICVTYPLERFQAIGEQ
LQINQPNVYDCGVPASLASLVPALADVCNNSQGQMAYSNLPHPQPASNRSVSLTSLGGTE
FISFAKGRSFNNDLYHSWVAPSLQSDLLVQFWIRSVGILPSDCSQGWKVLDIQLISPGGR
ITFKASNDHSKWAVSTTGGGVDGAAGWVCVGDINRNEAEEKRGGGTVCLRDATVWKAYRT
AALECEMCGGGTSGCDVDVEDARHYQGDMNQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcacttgttgtcctgctgatcctgtttcaaccaggagagggaggcacctcacct
atctcctgttacaatgatcaaggggaagctgtagactggttctatctctacaaactcccc
catgttgatcgtgaatttcccaacgatggacagagttatctactgatggacaaagggagc
gagggatggacggatggaaacgtgttggtgaatgacagcactggagccctggggaggact
gtgggccagctgtatgagcaggggaagaatgctgacattgcatacatcctgtacaatgac
cagagaccacccgaggagggagaaagagggtttggtttccttagtaaccgaggtggccac
actaaaggtgttgtcttattggacaagacacagggctactggttggtccacagcacccct
catttcccccctgtaaaggaaatagggcaatattcctacccaggtagtggtgtacagaac
ggacagaacttcatctgtgtgacctacccactggaacgctttcaggccattggagagcag
ttgcagatcaaccagcccaatgtgtatgactgtggtgtccctgcttccttggcctctctg
gtgcccgcactggctgacgtctgtaacaacagccaagggcagatggcctatagcaactta
ccgcacccccaacctgcatccaatcgcagtgtgtctctcacctcattgggtggaaccgag
ttcatcagctttgccaaggggagatcattcaataatgatctgtaccactcctgggtggct
ccctccctccagtcagacctcctagtccagttctggatccgctccgttggcatcctgccc
tctgactgctcccagggctggaaggtcctggacatccagcttatctccccaggcgggagg
atcaccttcaaggcctccaacgaccactcaaagtgggccgtgagtaccaccgggggtggg
gtggatggagctgctggctgggtgtgtgtgggcgacatcaaccggaacgaggctgaggag
aagagggggggcgggactgtgtgtctgcgggacgccacggtgtggaaggcctatcggaca
gcggcgctggagtgtgagatgtgcgggggagggactagcgggtgtgatgtggacgtagag
gatgcaaggcactaccagggagatatgaatcagtaa

DBGET integrated database retrieval system