KEGG   Salmo salar (Atlantic salmon): 106605334Help
Entry
106605334         CDS       T04363                                 

Definition
(RefSeq) soluble guanylate cyclase 88E-like
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00230  Purine metabolism
sasa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106605334
Enzymes [BR:sasa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     106605334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HNOBA Guanylate_cyc HNOB
Motif
Other DBs
NCBI-GeneID: 106605334
NCBI-ProteinID: XP_014056306
UniProt: A0A1S3RVJ0
Position
ssa05
AA seq 843 aa AA seqDB search
MYGLYLEAVNDYINESYGEDVWRLIEARAEIPHLKFVRHQMYNDNLILRLAKAAGEVLGK
THDELMYAFGVYMVKRIGNYGYERILKVLGRNVRDFINELDNLHEYFRFSFPKVQPPSFC
VEEECETSLTLHYRSTRKGFTQFVKGQLSQVGRQFYNTDIEVEILSKEETEKMTYVIYKM
NFDNAAFKHRMPQQKTAPGYEKLPMKRGIFFDMFPFSVIFRRDMTMYRIGDGLKEVFSDL
QGKKVNEEFTLVRPMLEFSWDNIYTHLNNVFELLSKAVVESKQKVNVPKLSKEKEDEGKE
ESEKPKREEERGTEKSRVRPSPQSTDRRDVKSVEEMKGDQEFSSALTQYNSSANSGGEDI
ELLAFQTVTGKCSETIFEDMREPPKKPLHLKGQMKYVPQWDSLIFLSTPIIETVEDMIKM
GVYVNDLNLHDSSRELILAGTQQSAELQLALDQEQQKYAQLQEIIKKLDEEKKRGDSLLY
AMIPKAVADRLRKGITALETCQVFPDVTILFSDVVKFNEICIHITPMQVVDMLNEIYIVF
DTLSEKHNVYKVETIRDAYMVVAGVPNKTTFHAHHICDMALDMLSSIDHLKDPSTGDNIQ
IRVGIHSGMVVAGVVGLKMPRYCLFGDTVNTASRMESNGVGMQIHISQTTKDHLEHEPYI
IEERGKIFVKGKGYMKTYWLKGKKDLSFKTPAELRYSSEQKDSEDRSSNGSTCTNTKRST
SNLNIPNEEQAEGKPTPTELPAEPLPSLEGAPEDPTDPTEPQEKKVKKNTKNNNKGGVAK
PEAPPQQVNVVQESVVLPAAAQETPKAPPATAAPVLNNKKNSFRQHNKLPAHLPMRSTSC
CLL
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcctgtacttggaagcagtgaatgattatatcaacgagtcgtacggagaagat
gtatggagactgatagaggcccgggcagagataccgcatctcaagtttgtccgccatcag
atgtacaatgacaacctgatcctccggctggccaaggcagcaggggaggtcctggggaag
acccatgatgagctcatgtatgccttcggggtttacatggtgaagaggatcgggaactac
ggctacgagaggattctcaaggtgttggggcgtaatgtgcgtgacttcatcaatgagctg
gacaacctgcacgagtacttccgcttctccttccccaaggtgcagcctcccagcttctgt
gtggaggaggagtgtgagaccagcctcaccctgcactaccgcagcacccgcaagggcttc
acccagtttgtcaaaggccagctgtctcaagtgggaaggcagttctacaatacagacatt
gaagttgagatcctgtccaaagaggagactgagaagatgacctatgtgatctacaagatg
aactttgacaacgctgccttcaagcaccgcatgccccagcagaagacggccccggggtac
gagaagttacccatgaagaggggcatctttttcgacatgttcccctttagtgtgatcttc
cgccgggacatgaccatgtaccgcattggggacggcctaaaggaggtcttctccgacctg
cagggcaagaaggtcaacgaagagttcaccctggtgcggcccatgctggagttcagctgg
gacaacatctacacccaccttaacaatgtgtttgagctactgtccaaagctgtggtggag
agcaagcagaaggtgaatgtccctaaactgagcaaggaaaaggaagatgagggaaaagag
gagagcgagaaacccaagagagaggaagagagaggtacagagaagtcaagggtccgcccg
tcgccacagtcaaccgacaggagagatgtgaagtctgtggaggagatgaagggggaccag
gagttcagcagtgctctgactcagtacaacagctcagccaactcagggggagaggacatc
gagctgctcgccttccagactgtcaccgggaagtgcagtgaaaccatcttcgaggatatg
agggaacctcccaagaagcccctccacctgaagggtcaaatgaagtacgtcccccagtgg
gactcgctcatcttcctcagtacgcccattatagagacagtggaggacatgattaaaatg
ggtgtctatgtgaacgatctgaacctacacgactccagccgagagctcatcttagccgga
acacagcagtcggctgaacttcagctggctcttgaccaggagcagcagaagtacgcccag
ctccaggagatcatcaagaagctggacgaggagaagaagagaggagactccctcctctac
gccatgatccccaaagctgtggctgaccggctcaggaagggtatcacggccctggagaca
tgccaggtgttcccggacgtgaccatcctattcagcgacgtggtgaagttcaacgagatc
tgcatccacatcacgcccatgcaggtggtggacatgcttaacgagatctacatcgtcttc
gacacgctcagcgagaagcacaacgtctacaaggtggagaccatccgagatgcctacatg
gtggtagcaggcgtgcccaataaaacaaccttccatgcccaccacatatgtgacatggcc
ctggacatgctgagctccatcgaccacctcaaagacccctccactggagacaacatccag
atcagagtcgggatccactcagggatggtggtggctggggtggtggggctgaagatgcct
cgctactgtctgtttggagacaccgtcaacactgcctcccgcatggagagcaatggggtg
ggcatgcagatccacataagccagaccaccaaagaccacttggaacatgagccctacata
attgaggagaggggaaagatttttgtgaagggtaaaggctacatgaagacatattggctg
aaggggaagaaggacctgtcgtttaagactccagcagagctccgctacagcagtgaacag
aaggactcagaggacaggagctccaatgggtccacctgcaccaacaccaagcgctccacc
tccaacctgaacattcccaacgaggagcaggcagagggcaagcccacccccacagagttg
cctgcagagcccttaccttcactagaaggcgcccccgaggaccccacagaccccaccgag
ccccaggagaagaaagtaaaaaagaacactaagaacaacaacaaagggggcgtggccaag
cccgaagctcctccccagcaggtcaatgtggtgcaggagagtgtagtgcttcctgctgct
gcccaggagacccccaaggcccccccggccaccgccgccccagtgctcaacaacaagaag
aacagcttcaggcagcacaataagctgcccgcccaccttcccatgcgcagcacttcctgc
tgcctactgtga

DBGET integrated database retrieval system