KEGG   Salmo salar (Atlantic salmon): 106606258Help
Entry
106606258         CDS       T04363                                 

Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13-like
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04270  Vascular smooth muscle contraction
sasa04371  Apelin signaling pathway
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106606258
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106606258
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106606258
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    106606258
   04031 GTP-binding proteins [BR:sasa04031]
    106606258
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106606258
  Exosomal proteins of colorectal cancer cells
   106606258
GTP-binding proteins [BR:sasa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    106606258
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf
Motif
Other DBs
NCBI-GeneID: 106606258
NCBI-ProteinID: XP_014057881
UniProt: A0A1S3QPV9
Position
ssa06
AA seq 158 aa AA seqDB search
MVDVGGQRSERRRWFECFDSVTSILFLVSSSEYDQVLMEDRQTNRLSESLNIFETIVNNR
VFSNVSIILFLNKTDLLEDKVRSVSIKDYFPEYPGEPHSLVDVQRFLVDCFRGKRRDVTQ
KPLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLMLQ
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggtggacgttgggggtcaaaggtcggagagacggagatggtttgagtgttttgactct
gtcacctccatcctgttccttgtctcctcttcagagtatgaccaggtcttgatggaggac
cgtcagaccaaccgtctcagcgaatccctcaacatcttcgagaccatcgtcaacaatcgg
gttttctccaacgtctccatcatcctgttcctcaacaagacagaccttctggaggacaag
gtgcgctccgtcagcatcaaggactatttcccagagtaccccggggagccacacagcctg
gtcgacgtacagaggttcctagtggactgtttccgggggaagaggagggacgtgacacag
aagcccctgtaccaccacttcaccacagccatcaacacggagaacattcgcctggtgttc
cgagacgtcaaggacaccatcctccacgacaacctgaagcagctgatgctgcagtga

DBGET integrated database retrieval system