KEGG   Salmo salar (Atlantic salmon): 106606991Help
Entry
106606991         CDS       T04363                                 

Definition
(RefSeq) sphingosine kinase 1-like
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00600  Sphingolipid metabolism
sasa01100  Metabolic pathways
sasa04020  Calcium signaling pathway
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
Module
sasa_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    106606991
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    106606991
   04371 Apelin signaling pathway
    106606991
   04020 Calcium signaling pathway
    106606991
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     106606991
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat Tim54
Motif
Other DBs
NCBI-GeneID: 106606991
NCBI-ProteinID: XP_014058997
UniProt: A0A1S3S3Q9
Position
ssa06
AA seq 548 aa AA seqDB search
MDNDITQPDPSRQRNGVVEGLYGEFTDSLNAKVRYSVSLTESALTIQKISSPGQDEVVFH
LADCLGCRAYKVEDEADVGAFFTAYFYPFKRRWISTGMARQKVEQCFRVALVQDPLTNLQ
EAERWARAIREASIRQIPRRHDVKYYEVRRPCRVMVLVNPQSGRGQALQLFSGQIEPMLT
EASVPYTLVITEHQNHARDLVRETDLSQWDALVILSGDGLLFEVPQVLNGLLEREDWEEA
IQTPLGILPGGSGNALAASVHHYTKSPPAWGKELLLSCGFLLCKGLVTRLDLVSVHLASS
QRIFSFLSLAWGFVADVDIESEKYRLVGPMRFLVGTLMRLASLKVYQGRLAYLPAHPFTP
QNSSLCSSLPCGPNSSPNQNSRHNHSTNSNHNTAHNSSNIAITTMRTEPQPVNQKGPPDS
LLADLEQPVPEHWTVVNEEDFVLVLAMFQSHLAEDLFAAPGAAADDGFIHLLYVRAGISR
LALLTLFMTMEKGGHLAIGSPHLVYERVKAFRLEPLSPEGAITVDGEMVEYGPVQAQVHE
GIARLISG
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggataacgacatcacccaacctgacccatcccgtcagcgcaatggtgtcgtggaaggg
ctttatggagaattcacggactcgctcaacgcaaaggtcagatattctgtgagtttgact
gagagtgctctcactattcaaaagatctcgtcacctggacaggatgaggtggttttccat
ttagctgactgtcttggctgccgggcttataaagtggaggacgaagcagacgttggggcg
ttctttacagcctatttctacccgttcaagaggcgatggataagcacaggcatggcccgg
cagaaagtagagcagtgctttcgggtcgcactggtccaggaccctctcactaatcttcaa
gaggcagagagatgggcgcgtgccatcagagaagcttctatccgtcagatacccagacga
catgatgtgaagtactatgaggtacggcggccctgcagggtcatggttctggtgaacccc
cagagtgggcggggccaggctctccagcttttctccgggcaaatcgagcccatgctcacc
gaggcttcagtcccctacacattggtcatcactgagcaccagaaccatgcgagggacctg
gtgagagagactgatctgtcacagtgggacgctctggtcatcctgtcaggagacgggctg
ctgttcgaggtgccccaagtgttgaatggtcttctggagagagaggactgggaggaggcc
atccagaccccactgggcatcttaccagggggctcgggtaacgccctggcagcctccgtc
caccactacactaagtctcccccggcctggggtaaggagctgctgctgagctgtggcttc
ctgctgtgtaaaggcctggtgactcggctggacctggtctctgtccacctggcctccagc
cagcgcatcttctccttcctctccctggcctggggcttcgtggccgacgtcgacatcgag
agcgagaagtaccgcctcgttggccccatgcgattcctggtgggtacgctgatgcgcctg
gcctccctcaaggtatatcagggtaggctggcatacctgcctgctcatcccttcacaccc
cagaactcctccctctgctcctctctaccctgtgggcccaacagctcccccaatcagaac
tctcgccacaaccacagcacaaactccaaccacaacaccgcccacaactcctccaacatt
gccatcacaaccatgaggaccgagccccaaccagtcaaccagaaggggcctcctgactcg
ctcctagcagacctggagcagccggtgcctgagcattggacagtagtgaatgaggaagac
tttgtactggtactggccatgttccagtcccacttggctgaggacctgtttgccgcccct
ggggccgcagcagacgacggcttcatccacctgttgtatgtgcgtgcaggcatctccaga
ctagccctgctcacactcttcatgaccatggagaagggggggcacctggctattggctcc
ccacaccttgtgtatgagagggtgaaggcctttcgcctggagcctctgtcccccgaggga
gcgatcactgtggacggggagatggtggagtacgggccagtacaggcccaggttcatgaa
ggaatcgccaggctcatctcaggctga

DBGET integrated database retrieval system