KEGG   Salmo salar (Atlantic salmon): 106610008Help
Entry
106610008         CDS       T04363                                 

Definition
(RefSeq) guanylate cyclase soluble subunit alpha-3-like
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00230  Purine metabolism
sasa01100  Metabolic pathways
sasa04270  Vascular smooth muscle contraction
sasa04540  Gap junction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106610008
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    106610008
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106610008
Enzymes [BR:sasa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     106610008
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB TMEM126
Motif
Other DBs
NCBI-GeneID: 106610008
NCBI-ProteinID: XP_014064574
UniProt: A0A1S3SJS0
Position
ssa08
AA seq 723 aa AA seqDB search
MFCTKLKDLKISGECPFAGIGRVDEPGDFEERTSDHTGDVLAISKDVHGHVSEVLPQRKT
SKTRVNLHSLGESIRKLAFPEFQSLRTAFLQMMKRHTLDKKCPSVCYADICQDRTFDRPE
HLLEIMKNYSLKTGIHMDALKVSLGEELFQTCFDEDGHILRVVGGALSDFLNSFNVLLKQ
GSVPNPPELASLQANPDRITDHVNNEAASVLCLDKDLGLHTVYYFNPGQTTEFFFPGVIK
AAARLLYDTTVEVLMDMDMEMDLQGGTKESVGPLQFQAGPRQPTLLYSVVVKDAKSLSPS
PMRATSVGTMPTSLFSSTFPFHLFLDQDLGLLQIGDGLRKRLSRKDGLRRPAAFQEHFAI
VTPQIRCTFQGILTMLNTQFIIRIKHQGGSMADDTGRLMDLKGQMICISESNTILFLGSP
CVDKLEELTGRGLYLSDIPIHNALRDVVLVGEQAKAQDGLKKRLGKAKAALEHAHLALEE
EKKRTVDLLFTIFPGTVAQELWQGHTMDAREFEHVTMLFSDIVGFTAVCSRCTPMQVVTM
LNELYTRFDHHCGELDVYKVETIGDAYCVAGGLHKESETHAVQIALMALKMMELSDEVRT
PTGEPIKMRIGLHTGSVLAGVVGVMMPRYCLFGNNVALANKFESCSVPRRINVSPTTHRL
LKDCPEFVFIPRTRQDLPPNFPPDIPGVCYFLEAFDQWSGKTTSDCETDEPCYSNTNFMV
EQT
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgttttgcacaaaattgaaagacctgaaaatctctggagaatgcccattcgccggtatt
ggtcgtgtggacgaacccggagactttgaggaacgtacaagtgaccataccggggatgta
ctggcaatttccaaggatgtgcatggacatgtatcggaggtgctacctcaaaggaagaca
agcaagactagagtcaatcttcattcattaggggagagcatccgaaaattagcatttccc
gagtttcaaagcctgcgtactgcctttctgcaaatgatgaaacggcatacgttagacaag
aaatgcccttccgtgtgttatgcagacatctgtcaagataggacctttgatcgaccagag
catttactggagatcatgaagaattattctctcaaaacaggtattcacatggacgctttg
aaagtctcccttggcgaggagctgtttcaaacgtgcttcgacgaggacggccatattctg
cgggtggtggggggagccctcagcgacttcctgaacagcttcaatgtcctgttgaaacag
ggcagcgtcccaaaccctccagaactagcctctctgcaagccaacccagacagaataaca
gatcatgtaaacaacgaagcagcgtcggtgctgtgcctggacaaggatctgggtctgcac
accgtctactacttcaaccctgggcagaccacggagttcttcttccccggggtcatcaag
gcagccgcccgcctgctctacgacaccaccgtggaggtgttgatggacatggacatggag
atggaccttcaaggaggcaccaaggagagcgtaggccccttgcagttccaagctgggccc
cggcagcccaccctgctctactcggtggtggtgaaggatgccaagagcctgagccccagt
cccatgagggccacgtcggttgggaccatgcccacctccctcttctcctccaccttcccc
ttccacctctttctggatcaggacctgggcctgttgcaaatcggggatggcctccggaag
aggcttagccggaaggacggcctgaggcggcccgctgccttccaggagcactttgctatc
gtcacgccccagatcaggtgcaccttccaaggcatcttgactatgctgaacacacagttc
atcattcggataaagcaccaagggggctcaatggccgatgacacagggaggctcatggac
ctgaaaggccagatgatctgcatctcagagtccaataccatcctcttcctgggctcgccg
tgcgtagacaagctggaggagctgactggccgcggcctctacctctctgatatccccatc
cacaacgccctgcgcgacgtggtcctggtgggcgagcaggccaaggcccaggatggcttg
aagaaacgcctaggcaaggccaaggcggccctggagcacgctcacctcgccctggaggaa
gagaagaagaggacggtggatctgcttttcaccattttcccggggacggtggcccaggaa
ctttggcaaggccacacgatggatgccagggagtttgagcatgtcaccatgctgttctcg
gacatcgtgggcttcacggccgtgtgctcacgctgcacgcctatgcaggtggtcaccatg
ctcaatgagctgtacacacgctttgaccaccactgcggggagctggatgtatacaaggtg
gagactatcggtgacgcatactgtgtggctggtggcttgcacaaggagagcgagactcac
gcagtgcagattgccctcatggcgctgaagatgatggagctgtccgatgaggtcaggacg
cccactggcgagccaatcaagatgcgaattggcctgcacactggttcagttctggccggt
gttgttggcgtgatgatgccgcgctactgtctgtttggcaacaacgtcgcattggcaaat
aagtttgagtcctgtagcgtacctagaagaatcaacgttagccccacaacccacagattg
ctgaaagattgtccagagttcgtcttcattccccggaccagacaggatcttccgccaaac
ttcccgccggatattcctggtgtttgttacttcttggaggcttttgatcaatggtcgggc
aaaaccacaagtgactgtgagactgatgaaccatgctacagcaatacaaacttcatggtt
gagcaaacatag

DBGET integrated database retrieval system