KEGG   Salmo salar (Atlantic salmon): 106611529
Entry
106611529         CDS       T04363                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04080  Neuroactive ligand-receptor interaction
sasa04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106611529 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106611529 (apln)
SSDB
Motif
Pfam: Apelin OAD_beta
Other DBs
NCBI-GeneID: 106611529
NCBI-ProteinID: XP_014067295
UniProt: A0A1S3SSH3
Position
ssa09
AA seq 78 aa
MNVKILTLVIVLLVSLLCSASAGPIMASTEHGKALEEAGAVRRLVQQNPGRGGQSHRPAG
WKRRRPRPRLSHKGPMPF
NT seq 237 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgttctgcc
agtgctggtcccatcatggcctccacggagcatggcaaagcactagaagaggcgggcgcc
gtgagaaggctggtccagcagaaccccggcaggggtggccagagccacagaccggccggc
tggaagaggagacgcccacgaccccgtctctcccataaggggcccatgccattctag

DBGET integrated database retrieval system