KEGG   Salmo salar (Atlantic salmon): 106612562
Entry
106612562         CDS       T04363                                 

Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1-like
  KO
K04462  ecotropic virus integration site 1 protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106612562
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106612562
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    106612562
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_8 zf-BED SET
Other DBs
NCBI-GeneID: 106612562
NCBI-ProteinID: XP_014069290
UniProt: A0A1S3SY72
Position
ssa09
AA seq 1311 aa
MRSKGRARKLATSNGEDFALYPSDVLDDVCVSDGDPAAPTSAPPAEDSPSPGFSADDDAS
PLEPSPFHSALYMPQDEMPVPPDFQLRQSGIPGVGGGLGIWARRTVDVGERLGPYVGEQR
ACLRDPTQGWEILDGSGHVKFCVDASEPDIGSWLKHIQFSPTAHQHNLTPCQIDDQIFYR
VTREIKPGEELLLYMKAEDYSCDGMAPDMHEERQYRCEDCDQLFESVSELLDHQKVPCGT
PTSAFLGNPGGDSSDLEGPEGLEPHDLHLSHSLSHDGHDHDGPQECKECDQVFPDLQSLE
AHSLSHSEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCTKVQSCTCSKQVFTD
PSNLQRHIRSQHVGARAHACPDCGKTFATSSGLKQHKHIHSSVKPFICKSLRPFICEVCH
KSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFTAGGLFAHA
QGMSLPGVPGAMDKAAMGGMGHSSASLADYFGNRHHSGLTFPSAPGFPFSFPGLFSSGLY
HRPPLIPATSPVRRPPGPGTEHSKGPLLSPSPRAQEARELLKTLRKEASPGNEQPQGTEQ
QQAQGSSSKQRHGGGKMSSQSESSDLDDVSTPSGSDLDTTSGSELESDMESEGQRERAPR
ENGKGPKRKAGGGPQSPTILTSNHTKEFQGGPALFPPSLDEHTAVSGAVNDSIKAIASIA
ERYFGSTGLAGLQDKKVGALPYPSMFPLPFFPTFSPPVYPFPERELRPPGLKGEPQSPPD
EPSKKGQSRTSESPFDLTTKRKQEEKVPAPFAPISNSKPEASSRSTNQDQPLDLSMGGTR
HRSSSRTSRREESKKIHVFGEDKAGVDLPKADTSLQHARPTPFFMDPIYSRVEKRKMNDP
FEALKDKYMRPAPGFLFHPQFRMPDQRSWMSAIENMAEKLETFGSLNPESGDLMRSVPSM
FDFRAPPTALPETLLRKGKERYTCRYCGKLFPRSANLTRHLRTHTGEQPYRCKYCDRSFS
ISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNLSGTAASSPRSELDS
SSAILDDKEDSYFNEIRNFIGNTGQNQPSPDHSEEGLNGGPFEEEKPLMASHGSRDLDEG
EGEGEELGAEEEEGEQSDSAAGKPRDEAPPSNLDDDIIHNEIEFDGPSDLDLNCKTSPRR
DSVVSLLSSYEEEEDQSSYSALDHIRHFSDMHKMEDSEFSDGDGTAFGSPSLPEAVKQPL
YRKSKSQAYAMMLSLADKDALHPANHTPATMWHSLARAAAESSAIQSLSHV
NT seq 3936 nt   +upstreamnt  +downstreamnt
atgaggtccaaaggcagggcacggaaactggccacaagtaatggtgaggactttgccctt
tacccctctgatgtcctggatgatgtgtgtgtatcggacggagaccctgcggcaccaacc
tcggcccccccagcagaggactccccctcccctggcttctccgctgacgatgacgcctct
cccctggagccgtcccccttccactctgccctctacatgccccaggacgagatgcccgtt
ccccccgacttccagctgcgccagtcgggcatccccggtgtcggcggcggcctgggcatc
tgggcacggaggacggtggacgtgggcgagcgcttaggaccgtacgtgggtgagcagcgg
gcgtgcctgagagaccccacccaaggctgggagatcttggacgggtcgggccatgtaaag
ttctgtgtggatgccagcgagcctgatatcgggagctggctgaagcacatccagttttcc
cccacggcccaccagcacaacctgacgccgtgccagatagatgatcagatcttctacaga
gtgactcgagagatcaaaccaggagaggagctgcttctgtacatgaaggcagaggattat
tcatgtgacggcatggctcctgatatgcacgaggagagacagtatcgctgtgaggattgt
gatcagctctttgagtctgtctctgagctgctggaccaccagaaggttccatgtgggaca
cccacctcagccttcctggggaaccctggaggggacagtagtgacctggagggccccgaa
ggcctggagccccacgacctgcacctgtcccacagcctcagccacgacggccacgaccac
gacggcccccaggagtgtaaggagtgtgatcaggtgttccccgacctccagagtctggaa
gctcactctctgtctcactcggaggagagggaatacaagtgtgaccagtgccccaaggcc
ttcaactggaaatccaacctgattcgtcatcagatgtcacatgacagtggcaagcactac
gaatgtgaaaactgcacaaaggtacagtcatgtacctgctcaaagcaggtgttcacagac
cccagtaacctgcagaggcacatccgctcgcagcacgtgggggcgcgggctcacgcctgt
cccgattgcgggaagacctttgcaacgtcctctggcctgaagcagcacaagcacatccac
agcagtgtcaagcccttcatatgtaagtcactcagacccttcatatgtgaggtgtgccac
aagtcctacacgcagttctccaacctgtgccgccacaagcgcatgcacgctgactgccgt
acccagatcaagtgtaaggactgtggccagatgttcagcaccacctcctccctcaacaag
caccggcgcttctgtgagggcaagaaccatttcacggcaggggggttgttcgcccatgcc
cagggcatgtccctccccggtgtccctggtgccatggacaaggccgctatgggcgggatg
gggcacagcagtgccagcctggcagactactttgggaaccggcaccacagtggcctgacg
tttccgtccgcccctggcttccccttcagcttcccgggcctgttctcttctggactgtac
caccgaccccccctcatcccggccacctccccagtcagacggcccccaggtccaggtacg
gagcacagcaagggccccctcctgtcgcccagccccagggcccaggaggccagagagctg
ctcaagaccctccgcaaggaggcatcgcccggcaacgagcagccacaggggacagagcag
caacaggcccagggctcctcctccaagcagaggcacggcggcggcaagatgagcagccaa
tcagagagcagcgacctggatgacgtgagcacgcccagtgggagcgacctggataccacg
tcaggctcggagctggagagcgacatggagagcgaaggccagcgggagagggcaccccgg
gagaatgggaaggggcccaagaggaaggccggcggaggcccccagagccccaccatcctg
accagtaaccatactaaggagttccaaggcggccccgccttgttccctccctcgctggac
gagcacacggctgtctcaggggcagtcaatgactccatcaaagccatcgcctccatcgct
gagaggtactttggctccacggggctggcggggctgcaggacaagaaggtaggcgcgctg
ccctacccctccatgttccccctgcccttcttcccaaccttctccccgcccgtctacccc
ttcccagagagagagctcagacctccaggcctaaagggggagccccagtccccacctgac
gaaccctccaagaaaggccagagcaggacctctgagtcgccctttgaccttaccaccaag
cgcaagcaggaggagaaggtccccgccccctttgcccccatctccaattccaaaccagag
gcctcctcacgttccaccaatcaggaccagccgctggatttgagcatgggcggcacaagg
caccgcagcagtagccggacctcccggagggaggagtcgaagaagatccacgtgtttgga
gaagacaaggcaggggtggaccttcctaaagccgacacctctctgcagcacgctaggccc
acccccttcttcatggaccccatctacagcagggttgagaagaggaagatgaacgatccg
tttgaggctctgaaagacaagtacatgcggcccgcccccggcttcctcttccatccacag
tttcgtatgccagatcagagatcctggatgtcggccattgagaacatggcggagaagctg
gagacgtttggttcgcttaaccccgagtcaggtgacctgatgcgctccgtcccctccatg
tttgacttccgagccccgcccactgccctccccgagacgctactgcgcaagggcaaggag
cgctacacctgcagatactgcggtaaactattcccacggtctgccaacctgacccgccac
ttaaggacacacacgggagagcaaccgtacaggtgtaagtactgcgaccgctcgttcagc
atctcctccaacctgcagcgccacatccgcaacatccacaacaaggagaagcccttcaag
tgtcacctgtgtgaccgctgcttcggccagcagaccaacctggaccgtcacctcaagaag
cacgagaacggtaacctctcaggcacggctgcgtcctcccctcggtcagagctggacagc
agcagcgccatcctggacgacaaagaggactcctacttcaacgaaatacgaaactttatc
ggcaacacaggccagaaccagccgtcccctgaccattctgaggaagggttgaacgggggt
cctttcgaggaggagaagcccctgatggccagccacgggtcacgtgacctggatgagggg
gagggggagggggaggagcttggcgccgaggaggaggaaggggagcagagcgactccgct
gctgggaaacctagagacgaagctccccccagcaacctagatgatgacatcatacacaac
gaaatagaatttgacggacctagcgatttggacctcaactgcaagacctccccaaggagg
gattcggttgtctccctcctctccagctatgaggaggaagaggatcagagtagctactct
gcgctggatcacatccgtcacttctctgacatgcataagatggaagacagtgagttcagt
gacggggacggcaccgccttcggctcccccagcctgcctgaggccgtcaaacagcccttg
tacaggaaatccaagtcccaggcgtacgccatgatgctgtctctggctgataaggacgcg
ctccacccagccaaccacacaccagccaccatgtggcacagcctggcacgggccgctgct
gagtccagtgccatccagtccctcagccatgtatga

DBGET integrated database retrieval system