KEGG   Syntrophus aciditrophicus: SYN_01037Help
Entry
SYN_01037         CDS       T00346                                 

Definition
(GenBank) exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sat  Syntrophus aciditrophicus
Pathway
sat03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sat00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SYN_01037
Enzymes [BR:sat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SYN_01037
DNA repair and recombination proteins [BR:sat03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SYN_01037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 HHH_5 Viral_helicase1 AAA_11 Helicase_RecD T2SSE PIF1 RsgA_GTPase AAA_29 ArgK AAA_28 AAA_23 UvrD-helicase ABC_tran AAA_16 NTPase_1 DUF853 TrwB_AAD_bind HHH_2 AAA DUF2075 DEAD PhoH AAA_24 AAA_22 AAA_10 MobB UvrD_C MMR_HSR1 ResIII cobW ATPase_2 Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: ABC77457
UniProt: Q2LTP5
Position
1628097..1630358
Genome map
AA seq 753 aa AA seqDB search
MVSPLHIPGIFKMEKSPDRTHSSADPLVDLQGHIERVSYINEESGYTVARVKVSGHRDPV
TVVGGMMNPTPGEKVRMKGEWTNHPRFGEQFRLVFCESSVPATAVGIEKYLGSGLIKGIG
PVMARRMVEKFGEATLEIIDQDSARLQEVEGIGEKRITMIRRAWEEQREIRSIMIFLQSH
GVSAAYAARIFRQYGNAAIKVLQENPYRLATDIFGIGFLTADRIAEKMGFARDSHLRAEA
GILYVLHELSEEGHVTYPAGPLIRKCEETLEIDRKFIAAALEGIAGERQIVIEDGASFPE
ALPDRTVSLAKYHLSETQTAARLRILLNTPSALREIETEKAIAWVQEKLSLTLAHNQIEA
IRAAVSNKLLVITGGPGTGKTTIINAIIRIFSASGTKILLAAPTGRAAKRMSEATGMEAK
TIHRLLEYSPQKGGFQKDDTSPLDCEMLIVDEASMIDIILMHHLVKAIPLPSSFIMIGDG
DQLPSVGAGRVLNDVIESGCLPVVELREIFRQARESSIINNAHEINRGKFPRLQPPGDRL
DDFYFVEQEDPEKVVDLIIRLVRERIPQRFGLDPMEDIQVLTPMHRGLAGAGNLNSVLQA
TLNPGKDGLQRGGRFYLVGDKVMQIRNNYDRDVYNGDIGRIVRLDHELQEATLNFDGREV
VYEYGDLEEIVLSYAVSVHKSQGAEYPAVIMPLLMQHYMLLQRNLLYTAVTRGKKLVVII
GSKKALAIAVRNNKTHKRFTLLSQRLRKAMAES
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
ttggtgtcgccactccatattcccggaatctttaaaatggaaaaatccccggacagaacg
cattcctcggcagacccgctggttgaccttcaggggcacattgagcgcgtcagttacatc
aatgaagaaagcggttataccgttgcccgggtgaaggtatccggccaccgtgatccggtg
acggtggtgggcggcatgatgaaccccacgcccggggaaaaggtccggatgaagggggaa
tggacgaatcacccccggttcggggaacagttccgtctcgtgttctgcgaatcttccgtt
ccggcaacggccgtcggcatcgagaagtatctgggatcggggctgattaaagggattggc
cccgtcatggcacggcggatggtggagaagttcggcgaggccactctggaaatcatcgat
caggatagtgcccgccttcaggaagtggagggcatcggtgaaaaacggatcaccatgatc
cgcagggcatgggaagaacagcgggaaatccggtccatcatgatttttcttcagtcacat
ggggtcagcgcagcctatgcagcccggatcttccgtcagtacggcaatgccgccataaag
gtgcttcaggaaaacccctatcgccttgccacggatatcttcggaatcgggtttctcacg
gccgaccgaatcgctgaaaagatgggctttgcccgggattcccatctccgtgcggaagcg
ggaatcctctatgtccttcatgaactttccgaggagggccacgtcacttaccctgccggg
ccgctgatccgaaaatgtgaggaaaccctcgaaatcgatcggaaattcatcgctgcggct
ctggaagggattgccggagagcgacagatcgtcattgaagacggagcatctttccccgag
gcactcccggaccggaccgtttccctggcaaaatatcacctttcggaaacgcagaccgca
gccaggctgaggattctgctgaacactccgtcagctctccgtgaaatcgaaacagagaag
gccatcgcctgggtgcaggaaaaattatccctgactctggcgcacaaccagatcgaggcg
attcgtgccgccgtgtcgaataagctgctggtcataaccggcggaccggggacagggaaa
accacgattatcaatgcgatcattcgcattttttccgcatcggggaccaagattctgctg
gctgcgcccacggggagggcggccaaacgaatgagcgaagccacagggatggaggcgaag
acgattcaccggctgctggaatacagccctcagaagggtggattccagaaagacgacaca
tcccccctggactgcgagatgctgatcgtggacgaggcttcgatgatcgacatcatcctg
atgcatcaccttgtaaaggccattcctcttccgtcctctttcatcatgatcggggatggc
gatcaacttccctcagtgggagcgggccgcgttctgaatgacgtgatcgaatcgggttgc
ctgcctgtggtggaattgcgtgaaatcttccgtcaagcgcgggaaagctccattatcaac
aatgcccacgaaatcaaccgggggaaatttccccgcctccagccccccggagaccggttg
gatgacttctattttgtggaacaggaagatccggaaaaagtggtcgatctgattatccgc
ctggtaagggaacgcattccccagcgtttcgggcttgatccaatggaagacattcaggtg
cttactcccatgcatcggggtcttgccggggcggggaatctgaacagcgtcctgcaggcg
acactgaatcccggtaaagacggtctgcagaggggcgggaggttttacctcgtcggagac
aaggtcatgcagatccgcaataattatgaccgcgacgtttacaacggcgatatcggcagg
attgtccggctggaccatgaacttcaggaagccaccctgaactttgacgggcgcgaggtt
gtctatgagtatggcgatttggaggagattgtcctgtcgtatgccgtttctgtccacaaa
tcacagggggcggaatatcccgccgtgatcatgcctctgcttatgcagcattacatgctt
cttcagcggaatctcctctatacggcggttacgcgcgggaaaaaactggttgtgattatt
ggctcaaaaaaggcattggccatcgccgtccgtaacaacaaaacacataagcgtttcaca
ctgctcagccagcgtttgcggaaggcaatggccgaatcatga

DBGET integrated database retrieval system