KEGG   Syntrophus aciditrophicus: SYN_01681Help
Entry
SYN_01681         CDS       T00346                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sat  Syntrophus aciditrophicus
Pathway
sat00071  Fatty acid degradation
sat00280  Valine, leucine and isoleucine degradation
sat00310  Lysine degradation
sat00362  Benzoate degradation
sat00380  Tryptophan metabolism
sat00620  Pyruvate metabolism
sat00630  Glyoxylate and dicarboxylate metabolism
sat00640  Propanoate metabolism
sat00650  Butanoate metabolism
sat00900  Terpenoid backbone biosynthesis
sat01100  Metabolic pathways
sat01110  Biosynthesis of secondary metabolites
sat01120  Microbial metabolism in diverse environments
sat01130  Biosynthesis of antibiotics
sat01200  Carbon metabolism
sat01212  Fatty acid metabolism
sat02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SYN_01681
   00630 Glyoxylate and dicarboxylate metabolism
    SYN_01681
   00640 Propanoate metabolism
    SYN_01681
   00650 Butanoate metabolism
    SYN_01681
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SYN_01681
   00072 Synthesis and degradation of ketone bodies
    SYN_01681
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SYN_01681
   00310 Lysine degradation
    SYN_01681
   00380 Tryptophan metabolism
    SYN_01681
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SYN_01681
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SYN_01681
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SYN_01681
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sat04147]
    SYN_01681
Enzymes [BR:sat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SYN_01681
Exosome [BR:sat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SYN_01681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Thiolase_N ketoacyl-synt ACP_syn_III Ketoacyl-synt_C SpoVAD
Motif
Other DBs
NCBI-ProteinID: ABC78881
UniProt: Q2LXR7
Position
complement(3010219..3011385)
Genome map
AA seq 388 aa AA seqDB search
MSRVAVIGVGQSTFVRSYPGSIRELAFEAYSEAMKDANIQNADIDATVMCSAPEYDKQRS
PAGVVAEYLGLNPQPTFYVETLCSSSSTGLKLAYSLVASGLHDCVMVLGFQIMSQLTSNE
SQERMGRGADIQWESPFGTMMPAYYALHAQAHMAKYGTKPEDLALIRVKSATYGVLNERA
VYRKPVALEDFLDPQKMGGPVASPLRVGDCCANADGSSCIIVANEEKAKAFCKKPVWILG
IGSASAAVNMVGRESLTGLAVGIEAGRQAYKMAGITPKHIDVAEVHDCFTIAEMMAIENL
GFAEAGGGPELVRAKETYKEGSIPINIDGGLLSKGHPIGATGGSQVRTIVRQLRDEADNI
QVKDPMFGLVHNIGGVGLYGNVTIFGRE
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgagttgcagttattggcgttggacaaagcacctttgttcgaagctatcccggt
tccataagggagttggcgtttgaagcttatagtgaagcgatgaaggatgcaaatatacag
aatgcggacattgacgctacagtgatgtgctccgcccccgagtatgataagcagagatcc
ccggccggtgtcgtcgccgagtacctgggtttgaatcctcaaccgacgttctatgttgaa
actctctgttcatccagcagcacggggttgaagctggcctattccctggttgcatccgga
ctccatgactgtgtcatggtgcttggtttccagatcatgtctcagttgacctccaatgaa
tcccaggagagaatgggccggggcgcggatattcagtgggaatctcccttcggcacgatg
atgcccgcctactatgcccttcatgcccaggctcatatggcgaaatacggaacgaaaccg
gaagaccttgccctcattcgtgtaaaatcagccacctatggcgttctaaacgagagagct
gtttatcggaaaccggttgctctcgaggatttcctggatccgcagaagatgggcggcccg
gtcgccagtcctctgcgcgtgggtgactgctgcgcaaacgccgatggcagttcctgtatc
atcgttgccaatgaagaaaaagcgaaggcattctgcaagaaacccgtctggattctcggc
atcgggtcagcttcggcggcagtcaacatggtcggacgcgaatccctgacgggacttgcg
gttggcattgaagccggacgtcaggcttacaaaatggccggcattacgccaaagcatatc
gatgtcgctgaagtccatgactgtttcaccattgccgaaatgatggccatcgaaaatctc
ggctttgccgaagcgggtggcggtcctgaattagtccgtgcgaaagaaacctataaagaa
ggaagcattcccattaatatcgatggagggcttctttccaaggggcatcccattggagca
accggcgggtcgcaggttcggaccatcgtgcggcagttgagggatgaggccgataatatt
caggtaaaagatccgatgttcggattggttcataatatcggcggtgttggcttgtacgga
aatgtgactatttttgggagagaataa

DBGET integrated database retrieval system