KEGG   Syntrophus aciditrophicus: SYN_01744Help
Entry
SYN_01744         CDS       T00346                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
sat  Syntrophus aciditrophicus
Pathway
sat00471  D-Glutamine and D-glutamate metabolism
sat00550  Peptidoglycan biosynthesis
sat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sat00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SYN_01744
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SYN_01744
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sat01011]
    SYN_01744
Enzymes [BR:sat01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     SYN_01744
Peptidoglycan biosynthesis and degradation proteins [BR:sat01011]
 Precursor biosynthesis
  Amino acid ligase
   SYN_01744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Shikimate_DH NAD_binding_7 DUF4453 2-Hacid_dh_C Pyr_redox_2 AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: ABC76558
UniProt: Q2LR50
Position
676857..678218
Genome map
AA seq 453 aa AA seqDB search
MFFMDISGQRMLVIGWGKTGVASARFLISRGARVVVADEKNLSLENDVLSKLGEDHGQSV
ELADYGISALAQVDAVVPSPGVPPFHPVLKEAVKRCIPVISELELACRYLQTPMIAITGT
NGKTTTTSLIGEILSGSGRKVFVGGNIGTPLVEYVTGPQTADCAVVEISSFQLQWVDQFH
AFVSILLNTTCDHVNYHGSFEAYRAVKERIFNNQGKQDVAILNADEPDSAVLAESLSSPV
FFFSTTKMVERGLYQEKDRLICLDGEGKQEFYPLSMIRLPGAHNVENVMAAILASRACGC
SPENVINAISGFSGIAHRIEFTREIGGVKFYDDSKGTNVGAVKRAIETFSDPIILLMGGR
DKDGDFETLSALLQDRVKALVIFGEARERIQERIGGIVPTVLTPSLKEAIAAARRQACAG
DVVLLSPGCASFDEFADYKARGRFFKEEVRAFA
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgttcttcatggatatatcaggacagagaatgctggtaatcggctggggaaaaacgggt
gtcgcctccgcgcggtttctgatttctcgtggcgcccgggtcgtcgtggcggatgaaaaa
aatctttccctggaaaatgacgtactgtccaaacttggcgaagatcatggtcaaagcgtg
gaactggcggattatggaatatcggcgctggcccaggtcgatgccgttgtgccttcgccg
ggcgtgccgccgtttcatcccgttctgaaggaagccgtcaagagatgtatccccgttatc
agcgaactcgaactggcctgccgttatctccagacgcccatgatcgccattaccggaacg
aatggaaagacgaccacgacgagccttatcggagaaatactgagcggaagcggcagaaag
gtcttcgtgggtggaaatatcgggacgccgctggtggagtacgtgaccgggccgcagaca
gccgactgcgcggtcgtcgagatcagcagcttccagctccaatgggtggatcagtttcac
gcctttgtgtccattctactgaatacgacctgcgatcatgtaaattatcacggttcgttc
gaggcataccgggccgtcaaggaaagaattttcaacaatcagggaaaacaggatgtggcc
atcctgaatgccgacgaaccggattcggctgtgctggcagaatctctgtcatcaccggtc
ttttttttcagcaccacaaagatggttgaacgcggtctctatcaggaaaaggatcgattg
atctgtctcgacggagagggaaagcaggagttctatcctttgagtatgatccgtttgccg
ggggctcacaacgtcgagaatgtcatggctgccattttagcctcccgggcctgcggctgc
agtccggaaaacgtgatcaatgcgatatccggcttttcaggtatcgcccaccgcattgaa
tttacaagggagattggcggtgtgaagttttacgacgattccaagggaaccaacgtcggg
gccgtcaaacgggccatagaaaccttttcggacccgatcattctcctgatgggcggaagg
gacaaggatggagattttgaaacgctgagcgcccttttacaggaccgggtcaaggctctg
gtgattttcggcgaagcgagagaacggattcaggagcggatcggcgggatcgttcctacc
gttttaacgccctccctgaaggaggccattgcagccgcccgtcggcaggcttgtgccggg
gatgtcgtcctgttgtctcccgggtgtgccagttttgatgagtttgcagattataaggca
agagggagattctttaaggaagaagtgagggcttttgcatga

DBGET integrated database retrieval system