KEGG   Syntrophus aciditrophicus: SYN_02232Help
Entry
SYN_02232         CDS       T00346                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
sat  Syntrophus aciditrophicus
Pathway
sat00010  Glycolysis / Gluconeogenesis
sat00030  Pentose phosphate pathway
sat00051  Fructose and mannose metabolism
sat00680  Methane metabolism
sat01100  Metabolic pathways
sat01110  Biosynthesis of secondary metabolites
sat01120  Microbial metabolism in diverse environments
sat01130  Biosynthesis of antibiotics
sat01200  Carbon metabolism
sat01230  Biosynthesis of amino acids
Module
sat_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYN_02232
   00030 Pentose phosphate pathway
    SYN_02232
   00051 Fructose and mannose metabolism
    SYN_02232
  Energy metabolism
   00680 Methane metabolism
    SYN_02232
Enzymes [BR:sat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SYN_02232
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     SYN_02232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: ABC76493
UniProt: Q2LQY4
Position
614574..615674
Genome map
AA seq 366 aa AA seqDB search
MKTTLSIIKADVGSVGGHIRPSERLIQEVKNFVVEKGQGVISDFFISHTGDDIAILLSHS
RGKGDGIIHQLAWDAFVTGTKVAKEQGLYGAGQDLLKDSFSGNVRGMGPAVAEMEFEERP
NEPFLFFAADKTDPGAYNLPLYLAFTDPMYNSGLILSPTMNKGFRFVIMDVEYTEGDRVI
ELNAPEDIYDIAALLRDNERFVVEAIYSRSTGDIAVSVSTTRLHNIAGKYTGKDDPVMLV
RVQGTFPATGEVLAPFNIGHFVAGFMRGSHTGPLMPVKMNSGISYFDGPPIICCLAFCVH
KGKFTEPADAFDHPYWDYIRNNVARKATEMRAQGFSGAAMLPYSELEYGGIVEKMKILDE
RFKVRG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgacactgagtattattaaggctgatgtgggaagcgtcggagggcatatccgg
cctagtgaacggctgatccaggaagtgaaaaattttgtggtggagaagggtcagggagtc
atttccgattttttcatcagccatacaggtgacgacatcgcgattcttctctcccattcc
cgcggcaagggcgatgggatcatacaccagctggcttgggacgcctttgtgaccgggacc
aaggtggccaaagagcagggtctctatggcgccgggcaggatttgctgaaggattccttc
tccggtaacgtgaggggaatggggcctgcggtggcggagatggaattcgaagagcgaccg
aatgagcccttcctctttttcgccgccgataaaactgatcccggagcgtataacctgcct
ctttaccttgcctttacggaccccatgtacaattccggattgattctcagccctacgatg
aacaaagggttccgctttgtcatcatggatgtggaatacacggagggagacagggttatt
gaattgaacgccccagaggatatctacgatatcgctgcactattgagagacaacgagcgt
ttcgtcgtcgaggcgatctattcccgcagtaccggagacatcgctgtttccgtaagcacc
accaggcttcacaatattgcaggcaagtacacggggaaagacgatcctgtgatgctggtc
agagtccagggaaccttcccggccaccggcgaggtcttggcccccttcaacatcggccat
ttcgtggctggtttcatgagaggaagccacactgggccgttgatgccggtaaaaatgaat
tccggcatctcctatttcgatgggccgccgattatctgctgtcttgctttttgcgtccac
aagggaaaatttacggaacccgccgatgccttcgaccatccctactgggactacatccgg
aacaatgttgcgagaaaggcgaccgaaatgcgggctcagggtttctcaggagcggcgatg
cttccctacagtgaattggagtatggtggaattgtcgagaaaatgaagatccttgatgaa
cgatttaaagtgcggggttaa

DBGET integrated database retrieval system