KEGG   Sinomonas atrocyanea: SA2016_0299Help
Entry
SA2016_0299       CDS       T04286                                 

Definition
(GenBank) Putative low-affinity inorganic phosphate transporter Pit
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
satk  Sinomonas atrocyanea
Brite
KEGG Orthology (KO) [BR:satk00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SA2016_0299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AMM31000
UniProt: A0A126ZV36
Position
complement(306130..307146)
Genome map
AA seq 338 aa AA seqDB search
MAAALVGASIVLVCAFGLLNGFRDASNAVALTVRTRALTPGIAVVLTAGFNVLGTLAGAW
LLRAFGTVFVTVPAGSGGLTALAAALVAATLWGVYGWWKGYPSSSTHALVGGLIGATVAS
AILGGHLPGGLDQVFWLAIGLPLILSPLLAFGAAFVLTPAVTWMVRHTQPSQAHAGLRAA
QSVGAAIVAFGHGLQDGQRLVALLVLSTLGSGASFDHVPVWAAVLGALALGAGTLAGGWR
ITYTLSHRLVRMDPLRAFVSQLVTSAMLAFGSLGLHMPLSTTHTVVASVLGAGVNQDYSS
VNGPLVVRLIRFWLVAPLATAALGLVFALAFAPLAGLR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtggccgctgcgctcgtcggcgcatcgatcgtgctggtgtgcgcgttcggcttactcaac
ggcttccgcgacgcctccaacgcggtggccctcacggtccgcacccgcgcgctcacgccg
gggatcgccgtcgtcctcacggcggggttcaacgtgctcggcacgcttgccggggcgtgg
ctgctcagggccttcgggaccgtgttcgtgaccgtcccggccggcagcggggggctgacc
gcgctggcggcggcgctcgtcgcggcgaccctgtggggcgtctacggctggtggaagggc
tacccgtcctcgtccacccacgcgctcgtgggcggcctcatcggggcgaccgtcgcctcg
gcgatcctcggcggccacctgccgggcggcctcgaccaggtgttctggctcgcgatcggg
ctgccgctcatcctctcgcccctgctcgccttcggcgccgcgttcgtcctcacccccgcg
gtgacgtggatggtccgccatacccagccgagccaggcgcacgccggcctgcgcgccgcc
cagtcggtgggcgcggccatcgtggccttcgggcacgggctccaggacggccagcggctc
gtggcgctcctcgtcctctccacgctcggatccggcgcgagcttcgaccacgtccccgtg
tgggccgccgtgctgggcgcgctggcgctgggcgcgggcaccctcgccggcgggtggcgc
atcacctacacgctcagccaccggctcgtccgcatggaccccctgcgggccttcgtgtcc
cagctcgtcacgagcgcgatgctcgccttcggctccctcggcctccacatgccgctctcg
accacgcacacggtggtcgcctccgtgctgggggccggggtgaaccaggactattcgtct
gtgaacggtccgctcgtggtgcgcctcatccgcttctggctcgtcgccccgctcgcgacg
gcggccctcggcctggtcttcgcgctcgccttcgccccgctcgccggcctcaggtag

DBGET integrated database retrieval system