KEGG   Sinomonas atrocyanea: SA2016_3145Help
Entry
SA2016_3145       CDS       T04286                                 

Definition
(GenBank) Uroporphyrinogen-III C-methyltransferase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
satk  Sinomonas atrocyanea
Pathway
satk00860  Porphyrin and chlorophyll metabolism
satk01100  Metabolic pathways
satk01110  Biosynthesis of secondary metabolites
satk01120  Microbial metabolism in diverse environments
Module
satk_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:satk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SA2016_3145
Enzymes [BR:satk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     SA2016_3145
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     SA2016_3145
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     SA2016_3145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 Pyr_redox Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AMM33810
UniProt: A0A127A2Y1
Position
complement(3391902..3393143)
Genome map
AA seq 413 aa AA seqDB search
MSGIDLYPTTLRLLGRDVLVVGGGKVAARRAQGLLDAGAKVTVVAPEAAADVVRLAEAGL
VAWVRRGYETADLEGAWFVQTATGVPAVDARVAAEAEERRIWCVNAADHESSAAWTPATA
RVDDVTVAVNAGGDPRRAKALKDAVVLALRTGKLPLRRRRQGVGRVALVGGGPGDTGLIT
VRGRTLLAEADVVVADRLGPRGLLDELGDPAAGGPRVIEVGKAPGAHTATQEEINEILVR
EAQAGHVVVRLKGGDPYVLGRGGEEAEFCRRHGVDVEVVPGVTSAVSVPAAAGIPVTHRG
LATGFSVATGHDELAELPARPDHTIVLLMGVRRLAQSAAALRARGLGESTPVAIVERGWT
PEQRVTIGTLGTIVDRARAVGVANPAVIVIGDVVRVSPYAPSDIAHASLSTNR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcatcgacctgtaccccaccacgctgcgcctgctcggccgggacgtgctcgtc
gtaggcggcgggaaggtcgccgcccgcagggcccagggcctgctcgacgccggcgcgaag
gtgaccgtcgtggcgcccgaggcggcggccgacgtcgtgcgcctggctgaggcggggctc
gtcgcctgggtgcgccgcggctacgagacggccgacctcgagggcgcgtggttcgtccag
acggcgaccggcgtgccggcggtggacgcgcgcgtcgccgccgaggccgaggagcgccgc
atctggtgcgtcaacgccgccgaccacgagtcctccgccgcgtggacgccggcaaccgcc
cgggtggacgacgtgacggtcgccgtgaacgccgggggagacccgcgccgggccaaggcg
ctcaaggacgccgtggtgctcgcgctgcgcaccggcaagctcccgctgcgccggcgccgc
cagggcgtcggccgggtcgcgctcgtgggcggcggccccggcgacacggggctcatcacc
gtccggggacggaccctgctcgccgaggcggacgtggtcgtggcggaccggctcggcccg
cgcgggctcctcgacgaactcggcgatccggccgcgggcgggccccgggtgatcgaggtc
gggaaggccccgggcgcgcataccgccacccaggaagagatcaacgagatcctcgtccgc
gaggcgcaggcgggccacgtcgtggtccggctcaagggcggcgacccctacgtcctgggc
cgcggcggcgaggaggccgagttctgccggcgccacggcgtcgacgtcgaggtggtcccc
ggcgtcacgagcgccgtgtccgtgcccgccgccgccggcatcccggtcacccaccggggc
ctcgcgaccggcttcagcgtcgccacgggccacgacgagctcgccgagctccccgcgcgg
cccgaccacaccatcgtgctgctcatgggcgtgcgccgcctcgcccagtccgccgcggcc
ctgcgtgcgcgcggcctcggggagtcgacgccggtcgcgatcgtcgagcgcggctggacc
cccgagcagcgcgtcaccatcggcacactgggtacgatcgttgatcgggcccgtgccgtc
ggcgtcgcgaatcccgccgtgatcgtgatcggcgacgtcgtccgcgtgagcccgtacgcg
ccgtcggacatcgcccacgcctcgctctccacgaaccgctag

DBGET integrated database retrieval system