KEGG   Sinomonas atrocyanea: SA2016_3503Help
Entry
SA2016_3503       CDS       T04286                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
satk  Sinomonas atrocyanea
Pathway
satk00480  Glutathione metabolism
satk00590  Arachidonic acid metabolism
satk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:satk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    SA2016_3503
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SA2016_3503
Enzymes [BR:satk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SA2016_3503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AHJR-like
Motif
Other DBs
NCBI-ProteinID: AMM34163
UniProt: A0A127A4B3
Position
3775506..3775997
Genome map
AA seq 163 aa AA seqDB search
MELDAIEVALLDGRTTTFGEWAGKVRLVVNVASRCGLAPQYEQLEELQRRYGARGFTVLG
VPSNQFLQEYRNEGRIAEYCSATWGVTFPLLAKAWVNGRGQHPLYRELTKAPDAAGRAGR
VQWNFEKFLVLPDGAVHRFRPQTRPDDPAIVALIEGALPEAAG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggaactcgacgccatcgaggtcgccctgctggacgggcgcaccacgacgttcggcgag
tgggcgggcaaggtccggctcgtagtcaacgtggcgagccgctgcgggctcgccccgcag
tacgagcagctcgaggagctccagcggcggtacggcgcacgcggcttcacggtgctcggc
gtacccagcaaccagttcctccaggagtaccggaacgaggggcgcatcgcggagtactgc
tccgccacgtggggcgtgacgtttcccctgctggccaaggcctgggtgaacggccgcggg
cagcacccgctctaccgcgagctgaccaaggccccggacgccgcgggccgggccgggcgc
gtgcagtggaacttcgagaagttcctcgtgctgcccgacggcgcggtgcaccgcttccgc
ccccagacccggcccgacgatccggcgatcgtggccctcatcgagggcgcgctccccgag
gccgcaggctga

DBGET integrated database retrieval system